DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT4G04985

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_680599.1 Gene:AT4G04985 / 825840 AraportID:AT4G04985 Length:158 Species:Arabidopsis thaliana


Alignment Length:128 Identity:29/128 - (22%)
Similarity:49/128 - (38%) Gaps:25/128 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGEL-----------ILGGSDSGL--YS 263
            |::|.||.|.:....:|......::..||..|.:.   |||           :...||..|  |:
plant    13 ISVNGITIPNHLTPIKGNTIIDTWTTILNSAGESY---GELKSHIDNFIDEKLNNFSDGQLECYN 74

  Fly   264 GC----LTYVPVSSAGYWQFTMTSANLNG-FQFCEN---CEAI-LDVGTSLIVVPEQVLDTIN 317
            |.    |..:|..:..:::......:|.. ||..|.   |.|: :..|.:|.::...|....|
plant    75 GTVQRELASLPTVTLTFYKGVSLDLDLTSLFQQIEEEYFCLAVMMTPGINLNIIWTTVFQMYN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 29/128 (23%)
Asp 89..408 CDD:278455 29/128 (23%)
AT4G04985NP_680599.1 TAXi_C 5..149 CDD:291225 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.