DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT3G51330

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_566948.1 Gene:AT3G51330 / 824296 AraportID:AT3G51330 Length:529 Species:Arabidopsis thaliana


Alignment Length:446 Identity:88/446 - (19%)
Similarity:151/446 - (33%) Gaps:135/446 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IKHNLNVDDT----------KAKTKTDTKVPGSKVATLENLYNTE-------------------- 89
            :|.:|.:||.          |...:.|..:.|..:|:     |.|                    
plant    41 VKQSLGLDDLVPEKGSLEYFKVLAQRDRLIRGRGLAS-----NNEETPITFMRGNRTISIDLLGF 100

  Fly    90 -YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIK------------YNSSASTT 141
             :|..:..|.|.....|.:||||...| |...|..:   |...:|            |:.:.|:|
plant   101 LHYANVSVGTPATWFLVALDTGSDLFW-LPCNCGST---CIRDLKEVGLSQSRPLNLYSPNTSST 161

  Fly   142 YRAINTAFNIAYGSNSEEGPIALSGFQ----SQDTVNFAGYSIKNQIF-------------AEIT 189
            ..:|..:.:..:||:....|.:...:|    |:||  |...::...:.             |.||
plant   162 SSSIRCSDDRCFGSSRCSSPASSCPYQIQYLSKDT--FTTGTLFEDVLHLVTEDEGLEPVKANIT 224

  Fly   190 ---NAPETAFLKSQ--LDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAIN- 248
               ...:|.||:|.  ::|:||||....::.||       :|:..:..:.||:...    |.|: 
plant   225 LGCGKNQTGFLQSSAAVNGLLGLGLKDYSVPSI-------LAKAKITANSFSMCFG----NIIDV 278

  Fly   249 GGELILGGSDSGLYSGCLT-YVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSL--IVVPE 310
            .|.:..|  |.|......| .:|...:..:..::|..::.|........|:.|.|||.  ::.||
plant   279 VGRISFG--DKGYTDQMETPLLPTEPSPTYAVSVTEVSVGGDAVGVQLLALFDTGTSFTHLLEPE 341

  Fly   311 QVLDT---INQILGVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSG 372
            ..|.|   .:.:.....|        :|       |::.|.......|.|::....|...|...|
plant   342 YGLITKAFDDHVTDKRRP--------ID-------PELPFEFCYDLSPNKTTILFPRVAMTFEGG 391

  Fly   373 FTSMNGNSLL------------------------ILGEIFLGAYYTTYDIVYKLIG 404
            ......|.|.                        |:|:.|:..|...:|....::|
plant   392 SQMFLRNPLFIVWNEDNSAMYCLGILKSVDFKINIIGQNFMSGYRIVFDRERMILG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 80/409 (20%)
Asp 89..408 CDD:278455 79/402 (20%)
AT3G51330NP_566948.1 pepsin_retropepsin_like 102..453 CDD:416259 78/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.