DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT3G20015

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_188636.2 Gene:AT3G20015 / 821540 AraportID:AT3G20015 Length:470 Species:Arabidopsis thaliana


Alignment Length:434 Identity:89/434 - (20%)
Similarity:146/434 - (33%) Gaps:144/434 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTVLAVL--------AFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTD 71
            |||.|.|        :.|:.::..:|: ||::..| ....:|....|..:...:.|...|..:  
plant    37 LTVTATLPDFNNTHFSDESSSKYTLRL-LHRDRFP-SVTYRNHHHRLHARMRRDTDRVSAILR-- 97

  Fly    72 TKVPGSKVATLENLYNT----------------EYYTTLGFGNPPQDLKVLIDTGSANLWVLSSK 120
             ::.|..:.:.::.|..                ||:..:|.|:||:|..::||:||..:||....
plant    98 -RISGKVIPSSDSRYEVNDFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQP 161

  Fly   121 C------PDSVAPCANRIKY---NSSASTTYRAINTA-------FNIAYGSNS-EEGPIALSGFQ 168
            |      .|.|...|....|   :..:|...|..|:.       :.:.||..| .:|.:||    
plant   162 CKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLAL---- 222

  Fly   169 SQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRS 233
              :|:.||...::|                             :|           |..|..||.
plant   223 --ETLTFAKTVVRN-----------------------------VA-----------MGCGHRNRG 245

  Fly   234 VFSIYLNRNGTNAINGGELI----LGGSDSGLYSGCLTYVPVSSAGYWQF--------------- 279
            :|   :...|...|.||.:.    |.|...|.:..||......|.|...|               
plant   246 MF---IGAAGLLGIGGGSMSFVGQLSGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGASWVPLV 307

  Fly   280 ------TMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFLVDCSS 338
                  :.....|.|          |.||...|.:|:.|.|        |..|...||.:...::
plant   308 RNPRAPSFYYVGLKG----------LGVGGVRIPLPDGVFD--------LTETGDGGVVMDTGTA 354

  Fly   339 IGDLPDIVFTVARRKFPLKSSDYVLRYG----NTC--VSGFTSM 376
            :..||...:...|..|..::::.....|    :||  :|||.|:
plant   355 VTRLPTAAYVAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 74/359 (21%)
Asp 89..408 CDD:278455 73/336 (22%)
AT3G20015NP_188636.2 cnd41_like 130..470 CDD:133139 73/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.