DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT3G02740

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_186923.1 Gene:AT3G02740 / 821256 AraportID:AT3G02740 Length:488 Species:Arabidopsis thaliana


Alignment Length:368 Identity:86/368 - (23%)
Similarity:151/368 - (41%) Gaps:72/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YYTTLGFGNPPQDLKVLIDTGSANLWVLSS---KCPDSVAPCANRIKYNSSASTTYRAINTAFNI 151
            |:..:|.|.|.:|..|.:||||..|||..:   :||.. :.......|:..||:|.::::.:.|.
plant    85 YFAKIGLGTPSRDFHVQVDTGSDILWVNCAGCIRCPRK-SDLVELTPYDVDASSTAKSVSCSDNF 148

  Fly   152 -AYGSNSEEGPIALSGFQSQDTVNFA------GYSIKNQIFAEI---------TN---------- 190
             :|.:...|   ..||...|..:.:.      ||.:|:.:..::         ||          
plant   149 CSYVNQRSE---CHSGSTCQYVIMYGDGSSTNGYLVKDVVHLDLVTGNRQTGSTNGTIIFGCGSK 210

  Fly   191 -APETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELIL 254
             :.:....::.:|||:|.|.::.:..|      .|.:||.|.||......|.||......||::.
plant   211 QSGQLGESQAAVDGIMGFGQSNSSFIS------QLASQGKVKRSFAHCLDNNNGGGIFAIGEVVS 269

  Fly   255 GG-------SDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQV 312
            ..       |.|..||..|..:.|.:      ::...:.|.|...::...|:|.||:|:.:|:.|
plant   270 PKVKTTPMLSKSAHYSVNLNAIEVGN------SVLELSSNAFDSGDDKGVIIDSGTTLVYLPDAV 328

  Fly   313 LD-TINQILG-----VLNPTASNGVFLVDCSSIGDLPDIVF----TVARRKFPLKSSDYV--LRY 365
            .: .:|:||.     .|:....:.........:...|.:.|    :|:...:|   .:|:  :|.
plant   329 YNPLLNEILASHPELTLHTVQESFTCFHYTDKLDRFPTVTFQFDKSVSLAVYP---REYLFQVRE 390

  Fly   366 GNTCV----SGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIG 404
            ...|.    .|..:..|.||.|||::.|......|||..::||
plant   391 DTWCFGWQNGGLQTKGGASLTILGDMALSNKLVVYDIENQVIG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 86/368 (23%)
Asp 89..408 CDD:278455 86/368 (23%)
AT3G02740NP_186923.1 pepsin_A_like_plant 85..439 CDD:133143 86/368 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.