DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and NANA

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_187876.2 Gene:NANA / 820452 AraportID:AT3G12700 Length:461 Species:Arabidopsis thaliana


Alignment Length:497 Identity:113/497 - (22%)
Similarity:169/497 - (34%) Gaps:160/497 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLLLFWLTVLAVLAFEAEARK--RVRIGL-HKN---PEP---IEENIKNELK---TLSIKHNLNV 61
            |.||..|....:|...|::.|  .||:.| |::   |:|   ||:.|..:.|   .:|.|.|..|
plant    25 KTLLSCLITTLLLITVADSMKDTSVRLKLAHRDTLLPKPLSRIEDVIGADQKRHSLISRKRNSTV 89

  Fly    62 DDTKAKTKTDTKVPGSKVATLENLYNT-EYYTTLGFGNPPQDLKVLIDTGSANLWVL-------- 117
            .     .|.|.   ||.:.     |.| :|:|.:..|.|.:..:|::||||...||.        
plant    90 G-----VKMDL---GSGID-----YGTAQYFTEIRVGTPAKKFRVVVDTGSELTWVNCRYRARGK 141

  Fly   118 ---------SSK------------------------CPDSVAPCANRIKY--NSSASTTYRAINT 147
                     .||                        ||....||:...:|  .|:|...:.....
plant   142 DNRRVFRADESKSFKTVGCLTQTCKVDLMNLFSLTTCPTPSTPCSYDYRYADGSAAQGVFAKETI 206

  Fly   148 AFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASI 212
            ...:..|..:.. |..|.|..|    :|.|.|.:.                  .||:|||.|:..
plant   207 TVGLTNGRMARL-PGHLIGCSS----SFTGQSFQG------------------ADGVLGLAFSDF 248

  Fly   213 AINSITPPFYNLMAQGLVNRSVFSIYL-----NRNGTNAINGGELILGGSDSGLYSG------CL 266
            :..|.....|.         :.||..|     |:|.:|     .||.|.|.|...:.      .|
plant   249 SFTSTATSLYG---------AKFSYCLVDHLSNKNVSN-----YLIFGSSRSTKTAFRRTTPLDL 299

  Fly   267 TYVPV--------SSAGY---------WQFTMTSANLNGFQFCENCEAILDVGTSLIVVPE---- 310
            |.:|.        .|.||         |..|....            .|||.||||.::.:    
plant   300 TRIPPFYAINVIGISLGYDMLDIPSQVWDATSGGG------------TILDSGTSLTLLADAAYK 352

  Fly   311 QVLDTINQILGVLNPTASNGVFLVDCSS------IGDLPDIVFTV-ARRKFPLKSSDYVL--RYG 366
            ||:..:.:.|..|......||.:..|.|      :..||.:.|.: ...:|......|::  ..|
plant   353 QVVTGLARYLVELKRVKPEGVPIEYCFSFTSGFNVSKLPQLTFHLKGGARFEPHRKSYLVDAAPG 417

  Fly   367 NTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            ..|: ||.|....:..::|.|....|...:|::...:..||:
plant   418 VKCL-GFVSAGTPATNVIGNIMQQNYLWEFDLMASTLSFAPS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 86/408 (21%)
Asp 89..408 CDD:278455 85/402 (21%)
NANANP_187876.2 pepsin_A_like_plant 105..460 CDD:133143 86/404 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.