DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G42980

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_181826.1 Gene:AT2G42980 / 818900 AraportID:AT2G42980 Length:527 Species:Arabidopsis thaliana


Alignment Length:481 Identity:93/481 - (19%)
Similarity:154/481 - (32%) Gaps:165/481 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KNPEPIEENIKNELKTLS-IKH----------NLNVDD-----------TKAKTKTDTKV----- 74
            |..:|.:|:.:..:|..| ||.          :|.:.|           .|:|.:.:.||     
plant    65 KEHDPSKEHTRESVKPQSRIKQETKRTTHSVVDLQIQDLTRIKTLHARFNKSKKQKNEKVRKKIT 129

  Fly    75 ------------PGSKVATLEN---LYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDS 124
                        ||..:||||:   |.:.||:..:..|.||:...:::||||...|:....|.| 
plant   130 SDISLVGAPEVSPGKLIATLESGMTLGSGEYFMDVLVGTPPKHFSLILDTGSDLNWLQCLPCYD- 193

  Fly   125 VAPC--ANRIKYNSSASTTYRAI------------------------NTAFNIAYGSNSE-EGPI 162
               |  .|.:.|:...|.:::.|                        :..:...||..|. .|..
plant   194 ---CFHQNGMFYDPKTSASFKNITCNDPRCSLISSPDPPVQCESDNQSCPYFYWYGDRSNTTGDF 255

  Fly   163 ALSGFQSQDTVNFAG---YSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNL 224
            |:..|....|....|   |.:.|.:|.   .......|.|...|:||||...::.:|        
plant   256 AVETFTVNLTTTEGGSSEYKVGNMMFG---CGHWNRGLFSGASGLLGLGRGPLSFSS-------- 309

  Fly   225 MAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGF 289
            ..|.|...|.....::||...  |....::.|.|..|                   :...|||..
plant   310 QLQSLYGHSFSYCLVDRNSNT--NVSSKLIFGEDKDL-------------------LNHTNLNFT 353

  Fly   290 QFCENCEAILD-----------VGTSLIVVPEQVLDTINQILGVLNPTASNGVFLVDCSSIGDLP 343
            .|....|..::           ||...:.:||:..:        ::.....|..:...:::....
plant   354 SFVNGKENSVETFYYIQIKSILVGGKALDIPEETWN--------ISSDGDGGTIIDSGTTLSYFA 410

  Fly   344 DIVFTVARRKFPLKSSDY--------VLRYGNTC--VSGFTSMN--------------------G 378
            :..:.:.:.||..|..:.        ||   :.|  |||....|                    .
plant   411 EPAYEIIKNKFAEKMKENYPIFRDFPVL---DPCFNVSGIEENNIHLPELGIAFVDGTVWNFPAE 472

  Fly   379 NSLLILGE-----IFLGAYYTTYDIV 399
            ||.:.|.|     ..||...:|:.|:
plant   473 NSFIWLSEDLVCLAILGTPKSTFSII 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 76/397 (19%)
Asp 89..408 CDD:278455 73/387 (19%)
AT2G42980NP_181826.1 PLN03146 110..525 CDD:178691 84/436 (19%)
pepsin_A_like_plant 159..524 CDD:133143 73/387 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.