DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G39710

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_565911.1 Gene:AT2G39710 / 818555 AraportID:AT2G39710 Length:442 Species:Arabidopsis thaliana


Alignment Length:383 Identity:83/383 - (21%)
Similarity:148/383 - (38%) Gaps:104/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPD--SVAPCANRIKYN 135
            |:|.|....|...:|.....||..|:|||::.:::||||...|:...|.|:  ||        :|
plant    48 KLPQSSSDKLSFRHNVTLTVTLAVGDPPQNISMVLDTGSELSWLHCKKSPNLGSV--------FN 104

  Fly   136 SSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQ 200
            ..:|:||..:..:..|. .:.:.:.||..|   .....:....:|.   :|:.|:          
plant   105 PVSSSTYSPVPCSSPIC-RTRTRDLPIPAS---CDPKTHLCHVAIS---YADATS---------- 152

  Fly   201 LDGILGLGFASIAINSITPP--FYNLMAQGLVN------RSVFSIYLNRNGTNAIN--------- 248
            ::|  .|...:..|.|:|.|  .:..|..||.:      :|...:.:||...:.:|         
plant   153 IEG--NLAHETFVIGSVTRPGTLFGCMDSGLSSNSEEDAKSTGLMGMNRGSLSFVNQLGFSKFSY 215

  Fly   249 -------GGELILGGSDSGLYS--GCLTYVPV----SSAGYWQFTMTSANLNGFQFCENCEAILD 300
                   .|.|:||.:.   ||  |.:.|.|:    :...|:.....:..|.|.:          
plant   216 CISGSDSSGFLLLGDAS---YSWLGPIQYTPLVLQSTPLPYFDRVAYTVQLEGIR---------- 267

  Fly   301 VGTSLIVVPEQV------------LDTINQILGVLNP--TASNGVFLVDCSSI---GDLPDIVFT 348
            ||:.::.:|:.|            :|:..|...::.|  ||....|:....|:   .|.||.||.
plant   268 VGSKILSLPKSVFVPDHTGAGQTMVDSGTQFTFLMGPVYTALKNEFITQTKSVLRLVDDPDFVFQ 332

  Fly   349 VARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTT--YDIVYKLIG 404
                    .:.|...:.|:|     |..|.:.|.::..:|.||..:.  ..::|::.|
plant   333 --------GTMDLCYKVGST-----TRPNFSGLPMVSLMFRGAEMSVSGQKLLYRVNG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 80/374 (21%)
Asp 89..408 CDD:278455 78/367 (21%)
AT2G39710NP_565911.1 pepsin_A_like_plant 64..426 CDD:133143 78/367 (21%)
Asp 68..426 CDD:278455 78/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.