DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G36670

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_181205.2 Gene:AT2G36670 / 818239 AraportID:AT2G36670 Length:512 Species:Arabidopsis thaliana


Alignment Length:445 Identity:112/445 - (25%)
Similarity:171/445 - (38%) Gaps:114/445 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PIEENIK-NELKTLS-IKHNL------------NVDDTKAKTKTDTKVPGSKVATLENLYNTEYY 91
            |::|.:: :||:... ::|..            .|.|...:..:|..:.|||:..|       |:
plant    49 PLDELVELSELRARDRVRHARILLGGGRQSSVGGVVDFPVQGSSDPYLVGSKMTML-------YF 106

  Fly    92 TTLGFGNPPQDLKVLIDTGSANLWVLSSKC------------------PDSV----APCANRI-- 132
            |.:..|:||.:..|.|||||..|||..|.|                  |.|:    ..|::.|  
plant   107 TKVKLGSPPTEFNVQIDTGSDILWVTCSSCSNCPHSSGLGIDLHFFDAPGSLTAGSVTCSDPICS 171

  Fly   133 -KYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNF---AGYSIKNQIFAEITNAPE 193
             .:.::|:.........::..||..|     ..||:...||..|   .|.|:.....|.|.....
plant   172 SVFQTTAAQCSENNQCGYSFRYGDGS-----GTSGYYMTDTFYFDAILGESLVANSSAPIVFGCS 231

  Fly   194 T----AFLKSQ--LDGILGLGFASIAINS------ITPPFYNLMAQGLVNRSVFSIYLNRNGTNA 246
            |    ...||.  :|||.|.|...:::.|      ||||             |||..|..:|:  
plant   232 TYQSGDLTKSDKAVDGIFGFGKGKLSVVSQLSSRGITPP-------------VFSHCLKGDGS-- 281

  Fly   247 INGGELILGGSDSGLYSGCLTYVP-VSSAGYWQFTMTSANLNG---------FQFCENCEAILDV 301
             .||..:||   ..|..| :.|.| |.|..::...:.|..:||         |:.......|:|.
plant   282 -GGGVFVLG---EILVPG-MVYSPLVPSQPHYNLNLLSIGVNGQMLPLDAAVFEASNTRGTIVDT 341

  Fly   302 GTSLIVVPEQVLDTI-----NQILGVLNPTASNG--VFLVDCSSIGDL-PDIVFTVA-RRKFPLK 357
            ||:|..:.::..|..     |.:..::.|..|||  .:||. :||.|: |.:....| .....|:
plant   342 GTTLTYLVKEAYDLFLNAISNSVSQLVTPIISNGEQCYLVS-TSISDMFPSVSLNFAGGASMMLR 405

  Fly   358 SSDYVLRYG------NTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
            ..||:..||      ..|: ||... .....|||::.|......||:..:.||.|
plant   406 PQDYLFHYGIYDGASMWCI-GFQKA-PEEQTILGDLVLKDKVFVYDLARQRIGWA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 100/388 (26%)
Asp 89..408 CDD:278455 100/383 (26%)
AT2G36670NP_181205.2 pepsin_A_like_plant 105..462 CDD:133143 100/382 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.