DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G28220

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_180389.2 Gene:AT2G28220 / 817368 AraportID:AT2G28220 Length:402 Species:Arabidopsis thaliana


Alignment Length:376 Identity:81/376 - (21%)
Similarity:134/376 - (35%) Gaps:77/376 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TLSIKHNLNVDDTKAKTKTDT------KVPGSK--VATLENLYNTEYYTTLGFGNPPQDLKVLID 108
            |:|..|...:|..:.::.:.:      ::.|:.  ..||.: ||. |...|..|.||.::...||
plant    23 TVSSPHGFTIDLIQRRSNSSSFRLSKNQLQGASPYADTLFD-YNI-YLMKLQVGTPPFEIAAEID 85

  Fly   109 TGSANLWVLSSKCPDSVAPCANRIK--YNSSASTTY-----RAINTAFNIAYGSNSEEGPIALSG 166
            |||..:|.....|||    |.::..  ::.|.|:|:     ...:..:.|.|..|:..     .|
plant    86 TGSDLIWTQCMPCPD----CYSQFDPIFDPSKSSTFNEQRCHGKSCHYEIIYEDNTYS-----KG 141

  Fly   167 FQSQDTVNFAGYSIKNQIFAEI--------TNAPETAFLKSQLDGILGLGFASIA-INSITPPFY 222
            ..:.:||.....|.:..:.||.        |:...:.|..|. .||:||.....: |:.:..|:.
plant   142 ILATETVTIHSTSGEPFVMAETTIGCGLHNTDLDNSGFASSS-SGIVGLNMGPRSLISQMDLPYP 205

  Fly   223 NLMAQGLVNRSVFSIYLNRNGTNAINGGELILGG-----SDSGLYSGCLTYVPVSSAGYWQFTMT 282
            .|::.....:....|..   |||||..|:..:..     .|:..|             |......
plant   206 GLISYCFSGQGTSKINF---GTNAIVAGDGTVAADMFIKKDNPFY-------------YLNLDAV 254

  Fly   283 SANLN-----GFQF-CENCEAILDVGTSLIVVPEQVLDTINQ-----ILGVLNPTASNGVFLVDC 336
            |...|     |..| .|:...::|.|:::...|....:.:.:     :..|..|..|....|...
plant   255 SVEDNRIETLGTPFHAEDGNIVIDSGSTVTYFPVSYCNLVRKAVEQVVTAVRVPDPSGNDMLCYF 319

  Fly   337 SSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEI 387
            |...|    :|.|....|. ..:|.||...|.    :...|...|..|..|
plant   320 SETID----IFPVITMHFS-GGADLVLDKYNM----YMESNSGGLFCLAII 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 75/338 (22%)
Asp 89..408 CDD:278455 72/331 (22%)
AT2G28220NP_180389.2 PLN03146 12..398 CDD:178691 81/376 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.