DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G28040

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_180371.2 Gene:AT2G28040 / 817348 AraportID:AT2G28040 Length:395 Species:Arabidopsis thaliana


Alignment Length:322 Identity:71/322 - (22%)
Similarity:119/322 - (36%) Gaps:87/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GSKVATLENLYNT-EYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIK--YNSS 137
            ||..|  :.:::| ||...|..|.||.:::.::||||.::|.....|    ..|.|:..  ::.|
plant    52 GSPYA--DTVFDTYEYLMKLQIGTPPFEIEAVLDTGSEHIWTQCLPC----VHCYNQTAPIFDPS 110

  Fly   138 ASTTYRAI-------NTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETA 195
            .|:|::.|       :..:.:.||..|     ...|....:||..  :|...|.|.    .|||.
plant   111 KSSTFKEIRCDTHDHSCPYELVYGGKS-----YTKGTLVTETVTI--HSTSGQPFV----MPETI 164

  Fly   196 F--------LKSQLDGILGL--GFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAIN-G 249
            .        .|....|::||  |..|: |..:...:..||:.....:          ||:.|| |
plant   165 IGCGRNNSGFKPGFAGVVGLDRGPKSL-ITQMGGEYPGLMSYCFAGK----------GTSKINFG 218

  Fly   250 GELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLN-------GFQF-CENCEAILDVGTSLI 306
            ...|:.|  .|:.| ...:|..:..|::...:.:.::.       |..| ......::|.|::|.
plant   219 ANAIVAG--DGVVS-TTVFVKTAKPGFYYLNLDAVSVGNTRIETVGTPFHALKGNIVIDSGSTLT 280

  Fly   307 VVPEQVLDTINQILGVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNT 368
            ..||..                       |:.:....:.|.|..|  ||  .||.:..|..|
plant   281 YFPESY-----------------------CNLVRKAVEQVVTAVR--FP--RSDILCYYSKT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 68/316 (22%)
Asp 89..408 CDD:278455 67/308 (22%)
AT2G28040NP_180371.2 PLN03146 8..391 CDD:178691 71/322 (22%)
pepsin_A_like_plant 64..390 CDD:133143 67/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.