DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and mgc108380

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:412 Identity:134/412 - (32%)
Similarity:212/412 - (51%) Gaps:48/412 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLTVLAVLAFE-AEARKRVRIGLHKNPEPI-------EENIKNELKTLSIKHNLNVDDTKAKTKT 70
            |: |||.:..: :|...||.:..:|:...|       :|.:|...:..::|::.|       .|.
 Frog     3 WV-VLAFICLQLSEGLVRVPLKRYKSARDIMRERGILKEFMKTHKRDPALKYHFN-------EKY 59

  Fly    71 DTKVPGSKVATLENLY-NTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKY 134
            |..|      ..|.:| :|.||..:..|.|||:..||.||||:||||.|:.|....  |:|...:
 Frog    60 DFAV------AYEPMYMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSCQSEA--CSNHNLF 116

  Fly   135 NSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKS 199
            |.|.|:||.:....|:::|||.|      ::|....|||...|.|:.||.|........::|..|
 Frog   117 NPSQSSTYTSNGQQFSMSYGSGS------VTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYS 175

  Fly   200 QLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSG 264
            :.|||.|:.:.:::....|.....::.|.|:...:||:|::.      ..||:|.||.|:.||||
 Frog   176 KFDGIFGMAYPAMSAGGATTAMQGMLQQNLLTYPIFSVYMSS------QSGEVIFGGVDNNLYSG 234

  Fly   265 CLTYVPVSSAGYWQFTMTSANLNG--FQFC-ENCEAILDVGTSLIVVPEQVLDTINQILGVLNPT 326
            .:.:.||:...|||..:....:||  ..:| :.|:||:|.|||.:.:|:|.:.|:.|.||..|  
 Frog   235 QIQWSPVTQEVYWQIGIDEFLINGQATGWCSQGCQAIVDTGTSPLTIPQQYMGTLLQNLGAQN-- 297

  Fly   327 ASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSG-----FTSMNGNSLLILGE 386
             .||:|:|:|:|:.:||.|.|.:...:||:..|.|:::....|..|     ..|.||..|.|||:
 Frog   298 -YNGMFVVNCNSVQNLPTITFVINGVQFPIPPSGYIVQTNGYCTVGVEETYLPSQNGQPLWILGD 361

  Fly   387 IFLGAYYTTYDIVYKLIGLAPA 408
            :||..||:.||:....:|.|.|
 Frog   362 VFLRQYYSVYDMSNNRVGFAQA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 116/332 (35%)
Asp 89..408 CDD:278455 114/326 (35%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 6/27 (22%)
pepsin_retropepsin_like 71..383 CDD:386101 115/328 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.