DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and LOC613063

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001136375.1 Gene:LOC613063 / 613063 -ID:- Length:399 Species:Xenopus tropicalis


Alignment Length:419 Identity:143/419 - (34%)
Similarity:210/419 - (50%) Gaps:45/419 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLFWLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTDTKVP 75
            ||.|:.:||....: .....:||.|.|.|              ||:|.........|.....:||
 Frog     4 LLVWVVLLASSLLQ-PGSALIRIPLKKFP--------------SIRHTFTEAGKDVKELLANEVP 53

  Fly    76 ----------GSKV-ATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCA 129
                      |... ..|:|..:.:||..:|.|:|||:..|:.||||:||||.|..|......|.
 Frog    54 LKYSPGFPPSGEPTPEALKNYLDAQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACW 118

  Fly   130 NRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPET 194
            ...||:||.|:||....|||.|.||:.|      |||:.|:|||.....::|.|||.|....|..
 Frog   119 MHHKYDSSKSSTYVKNGTAFAIQYGTGS------LSGYLSKDTVTIGNLAVKGQIFGEAVKQPGV 177

  Fly   195 AFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDS 259
            .|:.::.|||||:.:..|:::.:.|.|.|:|||.||..::||.||||| .:...||||:|||:|.
 Frog   178 TFVAAKFDGILGMAYPVISVDGVPPVFDNIMAQKLVESNIFSFYLNRN-PDTQPGGELLLGGTDP 241

  Fly   260 GLYSGCLTYVPVSSAGYWQFTMTSANL-NGFQFCE-NCEAILDVGTSLIVVPEQVLDTINQILGV 322
            ..|:|...|:.|:...|||..|....: :....|: .||.|:|.|||||..|.:.:..:.:.:|.
 Frog   242 KYYTGDFHYLSVTRKAYWQIHMDQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGA 306

  Fly   323 LNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRY---GNT-CVSGFTSMN----GN 379
            :  ....|.::|.|..:..||.|..|:..:.:.|....|:::.   |:| |:|||..:|    ..
 Frog   307 V--PLIQGQYMVQCDKVPTLPVISLTLGGQVYTLTGEQYIMKVSQRGSTICLSGFMGLNIPPPAG 369

  Fly   380 SLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            .|.|||::|:|.||:.:|.....:|.|.|
 Frog   370 PLWILGDVFIGQYYSVFDRANDCVGFAKA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 124/333 (37%)
Asp 89..408 CDD:278455 123/328 (38%)
LOC613063NP_001136375.1 A1_Propeptide 22..50 CDD:311771 9/41 (22%)
Cathepsin_D2 73..397 CDD:133157 123/332 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.