DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Pga5

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:418 Identity:133/418 - (31%)
Similarity:202/418 - (48%) Gaps:57/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTD--TKVPG 76
            ||.||.::|.   :...|:|.|              :|..|::.||.    :::...|  .|.|.
Mouse     3 WLWVLGLVAL---SECLVKIPL--------------MKIKSMRENLR----ESQVLKDYLEKYPR 46

  Fly    77 SKVATL--------------ENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAP 127
            |:...|              .|..:..|...:..|.|||:.:|::||||:.|||.|..|  |...
Mouse    47 SRAHVLLEQRRNPAVTYEPMRNYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYC--SSPA 109

  Fly   128 CANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAP 192
            ||:...:|...|:|:.......|:||||..      :|||.:.|||.....::..|.|......|
Mouse   110 CAHHKAFNPLRSSTFLVSGRPVNVAYGSGE------MSGFLAYDTVRIGDLTVVAQAFGLSLEEP 168

  Fly   193 ETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGS 257
            ......:..|||||||:.::.:..|||.|.||..|||:.:::|:.||:....   .|..|:|||.
Mouse   169 GIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWLQGLIPQNLFAFYLSSKDE---KGSMLMLGGV 230

  Fly   258 DSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQF-CE-NCEAILDVGTSLIVVPEQVLDTINQIL 320
            |...|.|.|.:||||...|||..:.|.::||... |: .|:.|:|.||||:..|...:..|..::
Mouse   231 DPSYYHGELHWVPVSKPSYWQLAVDSISMNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLI 295

  Fly   321 GVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLR-YGNTCVSGF-TSMNGNS--- 380
            |.  ..:.:|.:.:.|.:|..|||||||:....:|:.:|.|:.: ..:.|.|.| ..|:..|   
Mouse   296 GA--KASGDGEYFLKCDTINTLPDIVFTIGSVTYPVPASAYIRKDRSHNCRSNFEEGMDDPSDPE 358

  Fly   381 LLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            :.:||::||..|:|.:|.....||||||
Mouse   359 MWVLGDVFLRLYFTVFDRANNRIGLAPA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 113/344 (33%)
Asp 89..408 CDD:278455 113/325 (35%)
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 8/45 (18%)
pepsin_retropepsin_like 64..385 CDD:299705 113/333 (34%)
Asp 74..386 CDD:278455 113/324 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.