DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Cym

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_064476.2 Gene:Cym / 56825 RGDID:708486 Length:379 Species:Rattus norvegicus


Alignment Length:404 Identity:129/404 - (31%)
Similarity:204/404 - (50%) Gaps:36/404 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSI------KHNLNVDDTKAKTKTDT 72
            ::.:|||||. |::....||.|||.     ::::|.||...:      :|.....:..:......
  Rat     4 FVLLLAVLAI-AQSHVVTRIPLHKG-----KSLRNTLKEQGLLEDFLRRHQYEFSEKNSNIGVVA 62

  Fly    73 KVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSS 137
            ..|      |.|..::||:..:..|.|||:.||:.||||:.|||.|..|...|  |.|..:::.|
  Rat    63 SEP------LTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYCSSKV--CRNHNRFDPS 119

  Fly   138 ASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLD 202
            .|.|::.::....:.||:.|.|      ||.:.|||..:...:.:|.....|..|...|..|..|
  Rat   120 KSFTFQNLSKPLFVQYGTGSVE------GFLAYDTVTVSDIVVPHQTVGLSTEEPGDIFTYSPFD 178

  Fly   203 GILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLT 267
            |||||.:.:.|.....|.|.|:|.:.||.:.:||:|::||.    .|..|.||..|...:.|.|.
  Rat   179 GILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRND----QGSMLTLGAIDQSYFIGSLH 239

  Fly   268 YVPVSSAGYWQFTMTSANLNG-FQFCE-NCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNG 330
            :|||:..||||||:....:|. ...|: .|.|:||.||:|:..|.:.:..|...:|.:.  ..:.
  Rat   240 WVPVTVQGYWQFTVDRITINDEVVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAVQ--GQHD 302

  Fly   331 VFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTT 395
            .|.:||..:..:|.:||.:..|:|||..|.|..::..:|.|||  .:|:.:.|||::|:..:|:.
  Rat   303 QFDIDCWRLNFMPTVVFEINGREFPLPPSAYTNQFQGSCSSGF--RHGSQMWILGDVFIREFYSV 365

  Fly   396 YDIVYKLIGLAPAI 409
            :|.....:|||.||
  Rat   366 FDRANNRVGLAKAI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 109/325 (34%)
Asp 89..408 CDD:278455 109/320 (34%)
CymNP_064476.2 A1_Propeptide 19..47 CDD:400357 8/32 (25%)
pepsin_retropepsin_like 64..377 CDD:416259 111/334 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.