DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Bace2

DIOPT Version :10

Sequence 1:NP_722706.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_062390.3 Gene:Bace2 / 56175 MGIID:1860440 Length:514 Species:Mus musculus


Alignment Length:38 Identity:11/38 - (28%)
Similarity:19/38 - (50%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TDAQRF-INRQMCTDPFHDAIG-YFNLIMIREPLWKQL 134
            ||:.|: .|.::|.....|.:| ..|..::....||:|
Mouse    29 TDSSRYEENFRLCFGLSEDRVGDICNACVLLVKRWKKL 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_722706.1 Asp 89..408 CDD:394983 11/38 (29%)
Bace2NP_062390.3 beta_secretase_like 85..446 CDD:133140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.