DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and pga4

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:410 Identity:142/410 - (34%)
Similarity:217/410 - (52%) Gaps:43/410 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLFWLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSI------KHNLNVDDTKAKT 68
            |||..|.||:...        |::.|.|.     |:.:|.|:.|.:      |:..|     ..:
 Frog     4 LLLLGLVVLSECV--------VKVPLRKG-----ESFRNRLQRLGLLGDYLKKYPYN-----PAS 50

  Fly    69 KTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIK 133
            |....:..|....|:|..:.|||.|:..|.|||:..|:.|||||||||.|..|..|.  |.|..:
 Frog    51 KYFPTLAQSSAEVLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYCSSSA--CTNHNR 113

  Fly   134 YNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLK 198
            :|...|||::|.||..:|.||:.|      :|||...||:......|.||:|....:.|.:....
 Frog   114 FNPQQSTTFQATNTPVSIQYGTGS------MSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYY 172

  Fly   199 SQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYS 263
            |..||||||.|.|||.:..||.|.|:.:|||:.:::||:||:.:|.   :|..::.||.|:..||
 Frog   173 SPFDGILGLAFPSIASSQATPVFDNMWSQGLIPQNLFSVYLSSDGQ---SGSYVLFGGVDTSYYS 234

  Fly   264 GCLTYVPVSSAGYWQFTMTSANLNG--FQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPT 326
            |.|.:||:::..|||..:.|.::||  ....::|:||:|.||||:..|...:..|...:|.... 
 Frog   235 GSLNWVPLTAETYWQIILDSISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQD- 298

  Fly   327 ASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSM----NGNSLLILGEI 387
             |||.::::|::|.::|.||||:...::||..:.||.:....|.|||.:|    |...|.|||::
 Frog   299 -SNGQYVINCNNISNMPTIVFTINGVQYPLPPTAYVRQNQQGCSSGFQAMTLPTNSGDLWILGDV 362

  Fly   388 FLGAYYTTYDIVYKLIGLAP 407
            |:..|:..:|.....:.:||
 Frog   363 FIRQYFVVFDRTNNYVAMAP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 123/329 (37%)
Asp 89..408 CDD:278455 123/325 (38%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 7/40 (18%)
pepsin_A 62..382 CDD:133145 123/332 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D356089at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.