DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and bace1

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_991267.1 Gene:bace1 / 403005 ZFINID:ZDB-GENE-040426-1835 Length:505 Species:Danio rerio


Alignment Length:374 Identity:95/374 - (25%)
Similarity:161/374 - (43%) Gaps:59/374 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SKVATLENLYNTE---YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSA 138
            |.:..::||....   ||..:..|:|.|.|.:|:||||:|..|.:     :..|..:|. |:.|.
Zfish    64 SFINMIDNLRGKSGQGYYIEMAVGSPAQRLNILVDTGSSNFAVGA-----AAHPFLHRY-YHRSL 122

  Fly   139 STTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNF---AGYSIKNQIFAEITNAPETAFLKSQ 200
            |::||.:.....:.|.....||.:      ..|.|:.   ...|::..| |.||.:.......|.
Zfish   123 SSSYRDLGRGVYVPYTQGRWEGEL------GTDVVSVPCGPNVSLRANI-AAITQSDRFFINGSN 180

  Fly   201 LDGILGLGFASIA--INSITPPFYNLMAQGLVNRSVFSIYL-----NRN---GTNAINGGELILG 255
            .:|||||.:|.||  ..::.|.|.:|:.|..| ..|||:.|     |.|   |:::..||.:|:|
Zfish   181 WEGILGLAYAEIARPDETLEPFFDSLLRQSTV-ADVFSLQLCGAGYNHNYSTGSSSTVGGSMIIG 244

  Fly   256 GSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENC------EAILDVGTSLIVVPEQVLD 314
            |.|..||.|.|.|.|:....|::..:....:||.....:|      ::|:|.||:.:.:|.:|..
Zfish   245 GVDPSLYVGELWYTPIRREWYYEVIIVRIEVNGQDLNMDCKEYNYDKSIVDSGTTNLRLPRKVFQ 309

  Fly   315 TINQILGVLNPTAS--NGVFLVD---CSSIGDLPDIVFTV---------ARRKFP--------LK 357
            ...:.:...:.|..  :|.:|.:   |...|..|..:|.|         ..:.|.        |:
Zfish   310 AAVKAIEAASSTEQFPSGFWLGEQLVCWQAGTTPWHIFPVISLYLMSENRNQSFRISILPQQYLR 374

  Fly   358 SSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
            ..:.|......|.. |.....::..::|.:.:..:|..::..:|.||.|
Zfish   375 PVEDVASAQEDCYK-FAVSQSSTGTVMGAVIMEGFYVVFERQHKRIGFA 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 93/367 (25%)
Asp 89..408 CDD:278455 92/362 (25%)
bace1NP_991267.1 beta_secretase_like 77..443 CDD:133140 92/361 (25%)
Asp 80..422 CDD:278455 91/356 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.