DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and CG31661

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster


Alignment Length:414 Identity:136/414 - (32%)
Similarity:203/414 - (49%) Gaps:41/414 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLFWLTVLA----VLAFEAEARKRVRIGLHKNPEP-IEENIKNELK------TLSIKHNLNVDD 63
            :|||.|.|..    |..|..|.|....   ||.|.. :....:|.|:      .|...:.:||..
  Fly     7 ILLFCLIVFVGGKKVHRFRLERRSHRH---HKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVTS 68

  Fly    64 TKAKTKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPC 128
            ...|....|:       .|.|.|:|.::..:..|:  |...:..||||::.||.||.|...:..|
  Fly    69 ESGKGVVITE-------PLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTC 124

  Fly   129 ANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPE 193
            .|:. :..|.|.::|:..|.|:|.|||.|.:|.:|      .|.|.|....|:||... :.|..:
  Fly   125 GNKF-FRKSNSKSFRSSGTPFSITYGSGSVKGIVA------SDNVGFGDLKIQNQGIG-LVNISD 181

  Fly   194 TAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSD 258
            :.   |..|||.|..|..:::....|.|..::.|.||.:.:||.:| ::|::  :||.:|||||:
  Fly   182 SC---SVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHL-KSGSS--DGGSMILGGSN 240

  Fly   259 SGLYSGCLTYVPVSSAGYWQFTMTSANLNG---FQFCENCEAILDVGTSLIVVPEQVLDTINQIL 320
            |.||.|.|||..|:.|.||.|.:....::|   .......:||:|.||||||.|...:..||:.:
  Fly   241 SSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDI 305

  Fly   321 GVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILG 385
            |..:....| ::.|.|.||..||.|||.:|.::|.:|...||:||.|.|.|.|..|.|....|||
  Fly   306 GAEHNKTYN-LYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDMLGLQYWILG 369

  Fly   386 EIFLGAYYTTYDIVYKLIGLAPAI 409
            :.|:...|..:|...:.:|:|||:
  Fly   370 DAFMRENYVEFDWARRRMGIAPAV 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 114/326 (35%)
Asp 89..408 CDD:278455 111/321 (35%)
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 114/336 (34%)
Asp 88..392 CDD:278455 111/320 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439952
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.