DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Bace2

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001002802.1 Gene:Bace2 / 288227 RGDID:1303241 Length:514 Species:Rattus norvegicus


Alignment Length:378 Identity:97/378 - (25%)
Similarity:164/378 - (43%) Gaps:76/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VATLENLYNTE---YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSAST 140
            :|.::||....   ||..:..|.|||.:::|:||||:|..|..:  |.|...    ..::|.:|:
  Rat    74 LAMVDNLQGDSGRGYYLEMLIGTPPQKVRILVDTGSSNFAVAGA--PHSYID----TYFDSESSS 132

  Fly   141 TYRAINTAFNIAYGSNSEEGPIA------LSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKS 199
            ||.:......:.|...|..|.:.      ..||.|...||.|      .||..     |..||..
  Rat   133 TYHSKGFEVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVNIA------TIFES-----ENFFLPG 186

  Fly   200 -QLDGILGLGFASIA--INSITPPFYNLMAQGLVNRSVFSIYLNRNGT----NAINGGELILGGS 257
             :.:|||||.:|::|  .:|:...|.:|:||..: ..:||:.:...|.    :..|||.|:|||.
  Rat   187 IKWNGILGLAYAALAKPSSSLETFFDSLVAQAKI-PDIFSMQMCGAGLPVAGSGTNGGSLVLGGI 250

  Fly   258 DSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENC------EAILDVGTSLIVVPEQVLDTI 316
            :..||.|.:.|.|:....|:|..:....:.|.....:|      :||:|.||:|:.:|::|.|.:
  Rat   251 EPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAV 315

  Fly   317 NQILG--VLNPTASNGVFL---VDCSSIGDLPDIVFTV---------ARRKF-----------PL 356
            .:.:.  .|.|..|:|.:.   :.|.:..:.|...|..         |.|.|           |:
  Rat   316 VEAVARTSLIPEFSDGFWTGAQLACWTNSETPWAYFPKISIYLRDENASRSFRITILPQLYIQPM 380

  Fly   357 KSSDY---VLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
            ..:.:   ..|:|   :|..|     :.|::|...:..:|..:|...:.:|.|
  Rat   381 MGAGFNYECYRFG---ISSST-----NALVIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 95/373 (25%)
Asp 89..408 CDD:278455 94/368 (26%)
Bace2NP_001002802.1 beta_secretase_like 85..446 CDD:133140 94/367 (26%)
Asp 88..425 CDD:278455 93/362 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.