DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT2G28225

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001324551.1 Gene:AT2G28225 / 28718311 AraportID:AT2G28225 Length:402 Species:Arabidopsis thaliana


Alignment Length:420 Identity:86/420 - (20%)
Similarity:141/420 - (33%) Gaps:136/420 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TLSIKHNLNVD------DTKAKTKTDTKVPGSKVATLENLYN-TEYYTTLGFGNPPQDLKVLIDT 109
            |.|..|...:|      ::.:...:..::.|:. ...:.||: :.|...|..|.||.::...|||
plant    23 TASSPHGFTIDLIQRRSNSSSSRLSKNQLQGAS-PYADTLYDYSIYLMKLQVGTPPFEIVAEIDT 86

  Fly   110 GSANLWVLSSKCPD---SVAPCANRIKYNSSASTTYR-----AINTAFNIAYGSNSEEGPIALSG 166
            ||..:|.....||:   ..||.     ::.|.|:|:|     ..:..:.|.|...:..     .|
plant    87 GSDIIWTQCMPCPNCYSQFAPI-----FDPSKSSTFREQRCNGNSCHYEIIYADKTYS-----KG 141

  Fly   167 FQSQDTVNFAGYSIKNQIFAEI--------TNAPETAFLKSQLDGILGLGFASIA-INSITPPFY 222
            ..:.:||.....|.:..:.||.        ||...:.|..|. .||:||....:: |:.:..|:.
plant   142 ILATETVTIPSTSGEPFVMAETKIGCGLDNTNLQYSGFASSS-SGIVGLNMGPLSLISQMDLPYP 205

  Fly   223 NLMAQGLVNRSVFSIYLNRNGTNAINGGE----------------------------LI--LG-- 255
            .|::.....:....|..   |||||..|:                            ||  ||  
plant   206 GLISYCFSGQGTSKINF---GTNAIVAGDGTVAADMFIKKDNPFYYLNLDAVSVEDNLIATLGTP 267

  Fly   256 --GSDSGLY--SG-CLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQ---- 311
              ..|..::  || .|||.|:|                  :|......::...:.:.||:.    
plant   268 FHAEDGNIFIDSGTTLTYFPMS------------------YCNLVREAVEQVVTAVKVPDMGSDN 314

  Fly   312 -------------------------VLDTINQILGVLNPTASNGVFLVDCSSIG----DLPDIVF 347
                                     |||..|..|    .|.:.|:|   |.:||    .:|.:..
plant   315 LLCYYSDTIDIFPVITMHFSGGADLVLDKYNMYL----ETITGGIF---CLAIGCNDPSMPAVFG 372

  Fly   348 TVARRKFPL--KSSDYVLRYGNTCVSGFTS 375
            ..|:..|.:  ..|..|:.:..|..|...|
plant   373 NRAQNNFLVGYDPSSNVISFSPTNCSALWS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 81/384 (21%)
Asp 89..408 CDD:278455 79/376 (21%)
AT2G28225NP_001324551.1 PLN03146 67..398 CDD:178691 77/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.