DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and asp-16

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_741674.1 Gene:asp-16 / 260226 WormBaseID:WBGene00012682 Length:395 Species:Caenorhabditis elegans


Alignment Length:353 Identity:110/353 - (31%)
Similarity:177/353 - (50%) Gaps:43/353 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCAN------RIKYNSSAST 140
            |.:.|:..|...:..|.|||...|::||.||||||:.:.| :|.|...|      :.|:|.:.|:
 Worm    60 LIDYYDDMYLANITVGTPPQPASVVLDTASANLWVIDAAC-NSQACNGNPGSGYTKQKFNPNKSS 123

  Fly   141 TYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQ-LDGI 204
            |:......|:|.|||.:.      ||:...|.:...|.::|.|.|...||.  .:.|.|: :|||
 Worm   124 TFVKGTRRFSIQYGSGTS------SGYLGTDVLQLGGLTVKAQEFGVATNL--GSVLGSEPMDGI 180

  Fly   205 LGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNR------NGTNAINGGELILGGSDSGLYS 263
            .|||:.:|:::.:|||..||::|..::..:|||:::|      .||    ||.:..|..|:....
 Worm   181 FGLGWPAISVDQVTPPMQNLISQKQLDAPLFSIWVDRKLQVSQGGT----GGLITYGAVDTKNCD 241

  Fly   264 GCLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTAS 328
            ..:.||.:||..||||.|....:..:...:..:||.|.|::.:.:|..||:.|.|      .|.:
 Worm   242 AQVNYVALSSKTYWQFPMDGVAIGNYAMMKQEQAISDTGSAWLGLPNPVLNAIVQ------QTKA 300

  Fly   329 N-----GVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYG---NTCVSGFTSMNGNSL---L 382
            .     .::.:|||::...||:|||:...::|:||.:|:|..|   ..||....|.:....   .
 Worm   301 TYDWNYEIYTLDCSTMQTQPDLVFTIGGMQYPVKSIEYILDLGLGNGRCVLAMLSYSNTGFGPSY 365

  Fly   383 ILGEIFLGAYYTTYDIVYKLIGLAPAIH 410
            :||.:|:..:...|||....||.|.|.|
 Worm   366 VLGHVFIRQFCNVYDIGNARIGFANAHH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 107/347 (31%)
Asp 89..408 CDD:278455 106/342 (31%)
asp-16NP_741674.1 Asp 68..391 CDD:365818 106/341 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.