DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and yps1

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_588035.1 Gene:yps1 / 2538927 PomBaseID:SPCC1795.09 Length:521 Species:Schizosaccharomyces pombe


Alignment Length:390 Identity:90/390 - (23%)
Similarity:144/390 - (36%) Gaps:108/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TEYYTTLGFGNPPQDLKVLIDTGSANLWV------------------------------LSSKCP 122
            |.|.|||..|.|.....|.||......|:                              |..|..
pombe    65 TYYTTTLSIGRPSISYTVAIDLDMPYTWLTYYNVMAFNPAYLGIVNSGTQWSTDELRYFLCKKES 129

  Fly   123 DSVAPCANRIKYNSSASTTYRAIN--TAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIF 185
            ||   |     |..:||:::..:.  :.|.|.|..|     |.::|...||:::::.|..     
pombe   130 DS---C-----YFGNASSSFHFVTSPSTFFIRYDDN-----ITVAGINVQDSLSYSHYQA----- 176

  Fly   186 AEITNAPETAF---LKSQL-------DGILGLGFASIAINSI---------TPPFY--NLMAQGL 229
                 .|:..|   ||..:       .|:|||. ||..||||         :||.:  .|:.:.:
pombe   177 -----LPDFQFGITLKEYVPSSMLPYKGVLGLA-ASTEINSIDYSDSISSFSPPTFLEQLVKEDI 235

  Fly   230 VNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCEN 294
            :....||:||:..|     .|.|:||..|:..|.|....:..:...::..::.|.......|..|
pombe   236 LAYPAFSMYLDNQG-----NGSLLLGAVDTSKYQGQFVALKQTKLTHYAVSIYSVQFLNSTFFSN 295

  Fly   295 CEAILD----VGTSLIVVPEQ----VLDTINQILGVLNPTASNGVFLVDCSSIGDLPDIVF---- 347
            ...|.|    ...:.|.:|.:    |:|.....|       |.|.|.::|..|.....::|    
pombe   296 YSIITDAYFQTRETYIYLPAELAYSVMDNAGAYL-------SEGYFALNCDEIDLEAALIFQFGC 353

  Fly   348 --TVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPAIH 410
              |:   |.|: |...:.:..|.|:.|... :.:|.::||.:|....||.|....|:|.:..|.:
pombe   354 NSTI---KVPI-SLLVIGQVSNICLLGIRP-STDSEIVLGLLFFRNAYTFYHQSQKMIAIGQAFY 413

  Fly   411  410
            pombe   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 89/384 (23%)
Asp 89..408 CDD:278455 88/385 (23%)
yps1NP_588035.1 Asp 66..411 CDD:278455 88/385 (23%)
pepsin_retropepsin_like 150..411 CDD:299705 70/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.