DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Ren

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_036774.4 Gene:Ren / 24715 RGDID:3554 Length:402 Species:Rattus norvegicus


Alignment Length:420 Identity:145/420 - (34%)
Similarity:204/420 - (48%) Gaps:50/420 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLFWLTVLAVLAFEAEARKRVRIGLHKNP---EPIEENIKNELKTLSIKHNLNVDDTK------ 65
            |||.|.:  ...:...:.....||.|.|.|   |.:||.              .||.|:      
  Rat    11 LLLLWTS--CSFSLPTDTASFGRILLKKMPSVREILEER--------------GVDMTRISAEWG 59

  Fly    66 --AKTKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPC 128
              .|..:.|.|....|.|  |..:|:||..:|.|.|.|..||:.|||||||||.|:||......|
  Rat    60 EFIKKSSFTNVTSPVVLT--NYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYTAC 122

  Fly   129 ANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPE 193
            .....|:||.|::|....|.|.|.|||..      :.||.|||.|...|. |..|.|.|:|..|.
  Rat   123 EIHNLYDSSESSSYMENGTEFTIHYGSGK------VKGFLSQDVVTVGGI-IVTQTFGEVTELPL 180

  Fly   194 TAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSD 258
            ..|:.::.||:||:||.:.|::.:.|.|.::::|.::...|||:|.:|.  :.:.|||::|||||
  Rat   181 IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRE--SHLLGGEVVLGGSD 243

  Fly   259 SGLYSGCLTYVPVSSAGYWQFTMTSANLN-GFQFC-ENCEAILDVGTSLIVVPEQVLDTINQILG 321
            ...|.|...||.:|.||.||.||...::. ....| |.|.|::|.|||.|..|...|..|.|.||
  Rat   244 PQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSLQLIMQALG 308

  Fly   322 VLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYV----LRYGNTCVSGFTSMN----G 378
            |....|:|  ::|:||.:..||||.|.:..|.:.|.:.|||    .|..:.|:.....::    .
  Rat   309 VKEKRANN--YVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCILALQGLDIPPPT 371

  Fly   379 NSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            ..:.:||..|:..:||.:|.....||.|.|
  Rat   372 GPVWVLGATFIRKFYTEFDRHNNRIGFALA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 123/333 (37%)
Asp 89..408 CDD:278455 122/328 (37%)
RenNP_036774.4 A1_Propeptide 31..64 CDD:400357 11/46 (24%)
renin_like 76..401 CDD:133154 125/337 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.