DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and BACE1

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens


Alignment Length:387 Identity:97/387 - (25%)
Similarity:171/387 - (44%) Gaps:63/387 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KTKTDTKVPGSKVATLENLYNTE------YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSV 125
            :|..:.:.||.:.:.:|.:.|..      ||..:..|:|||.|.:|:||||:|..|  ...|.  
Human    46 ETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAV--GAAPH-- 106

  Fly   126 APCANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNF---AGYSIKNQIFAE 187
             |..:|. |....|:|||.:.....:.|.....||.:      ..|.|:.   ...:::..| |.
Human   107 -PFLHRY-YQRQLSSTYRDLRKGVYVPYTQGKWEGEL------GTDLVSIPHGPNVTVRANI-AA 162

  Fly   188 ITNAPETAFLKSQLDGILGLGFASIA--INSITPPFYNLMAQGLVNRSVFSIY-------LNRNG 243
            ||.:.:.....|..:|||||.:|.||  .:|:.|.|.:|:.|..| .::||:.       ||::.
Human   163 ITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHV-PNLFSLQLCGAGFPLNQSE 226

  Fly   244 TNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENC------EAILDVG 302
            ..|..||.:|:||.|..||:|.|.|.|:....|::..:....:||.....:|      ::|:|.|
Human   227 VLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSG 291

  Fly   303 TSLIVVPEQVLDTINQILGVLNPTAS--NGVFLVD---CSSIGDLPDIVF--------------- 347
            |:.:.:|::|.:...:.:...:.|..  :|.:|.:   |...|..|..:|               
Human   292 TTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQS 356

  Fly   348 ---TVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
               |:..::: |:..:.|....:.|.. |.....::..::|.:.:..:|..:|...|.||.|
Human   357 FRITILPQQY-LRPVEDVATSQDDCYK-FAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 93/370 (25%)
Asp 89..408 CDD:278455 92/365 (25%)
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 3/11 (27%)
beta_secretase_like 72..437 CDD:133140 92/361 (25%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4239
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.