DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and Cym

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:403 Identity:128/403 - (31%)
Similarity:206/403 - (51%) Gaps:34/403 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTDTKVPGSK 78
            ::.:||.||. :::....||.|||.     ::::|.||...:     ::|..::.:.:.....|:
Mouse     4 FVLLLAALAI-SQSHVVTRIPLHKG-----KSLRNTLKEQGL-----LEDFLSRQQYEFSEKNSR 57

  Fly    79 VAT-----LENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSA 138
            :..     |.|..::||:.|:..|.|||:..|:.||||:.|||.|..|...|  |.|..:::.|.
Mouse    58 IGVVASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCNSKV--CRNHHRFDPSK 120

  Fly   139 STTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDG 203
            |.|::.::....:.||:...|      ||.:.|||..:...:.:|.....|..|...|..|..||
Mouse   121 SITFQNLSKPLFVQYGTGRME------GFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDG 179

  Fly   204 ILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTY 268
            ||||.:.:.|.....|.|.|:|.:.||.:.:||:|::||.    .|..|.||..|...:.|.|.:
Mouse   180 ILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRNE----QGSMLTLGAIDQSYFIGSLHW 240

  Fly   269 VPVSSAGYWQFTMTSANLNG-FQFCE-NCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGV 331
            |||:..||||||:....:|| ...|: .|.|:||.||:|:..|.:.:..|.|::|.:.  ..|..
Mouse   241 VPVTVQGYWQFTVDRITINGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQ--GHNDQ 303

  Fly   332 FLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTY 396
            |.:||..:..:|.:||.:..|:|||....|..:....|.|||  ..|:.:.|||::|:..:|:.:
Mouse   304 FDIDCWRLDIMPTVVFEIHGREFPLPPYAYTNQVQGFCSSGF--KQGSHMWILGDVFIREFYSVF 366

  Fly   397 DIVYKLIGLAPAI 409
            |.....:|||.||
Mouse   367 DRANNRVGLAKAI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 110/325 (34%)
Asp 89..408 CDD:278455 110/320 (34%)
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240 9/34 (26%)
pepsin_retropepsin_like 64..377 CDD:299705 111/328 (34%)
Asp 73..378 CDD:278455 110/320 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.