DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and asp-4

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_510191.1 Gene:asp-4 / 181444 WormBaseID:WBGene00000217 Length:444 Species:Caenorhabditis elegans


Alignment Length:402 Identity:142/402 - (35%)
Similarity:205/402 - (50%) Gaps:39/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTDTKVPGSKVA 80
            |:|...:||..|:.|             ...|..|||   ..|.:.|..:|     ..|.|....
 Worm    41 TLLQAGSFETFAKHR-------------HGYKKYLKT---NGNHHFDKYQA-----LNVEGEIDE 84

  Fly    81 TLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSASTTYRAI 145
            .|.|..:.:|:.|:..|.|.|:..|:.||||:|||:.|.|||.....|....:|:|.:|:||:..
 Worm    85 LLRNYMDAQYFGTISIGTPAQNFTVIFDTGSSNLWIPSKKCPFYDIACMLHHRYDSKSSSTYKED 149

  Fly   146 NTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFA 210
            .....|.||:.|      :.||.|:|:|..||...::|.|||.|:.|...|:.::.|||||:.:.
 Worm   150 GRKMAIQYGTGS------MKGFISKDSVCVAGVCAEDQPFAEATSEPGITFVAAKFDGILGMAYP 208

  Fly   211 SIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAG 275
            .||:..:.|.|..|..|..|..::||.:||||..:.| |||:..||.||..|...:|||||:..|
 Worm   209 EIAVLGVQPVFNTLFEQKKVPSNLFSFWLNRNPDSEI-GGEITFGGIDSRRYVEPITYVPVTRKG 272

  Fly   276 YWQFTMTSANLNGFQFCEN-CEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFLVDCSSI 339
            ||||.|.....:|...|.| |:||.|.|||||..|:..::.|...:|. .|.. .|.:::.|..:
 Worm   273 YWQFKMDKVVGSGVLGCSNGCQAIADTGTSLIAGPKAQIEAIQNFIGA-EPLI-KGEYMISCDKV 335

  Fly   340 GDLPDIVFTVARRKFPLKSSDYVLRY---GNT-CVSGFTSMN----GNSLLILGEIFLGAYYTTY 396
            ..||.:.|.:..::|.||..||||:.   |.| |:|||..::    ...|.|||::|:|.||:.:
 Worm   336 PTLPPVSFVIGGQEFSLKGEDYVLKVSQGGKTICLSGFMGIDLPERVGELWILGDVFIGRYYSVF 400

  Fly   397 DIVYKLIGLAPA 408
            |.....:|.|.|
 Worm   401 DFDQNRVGFAQA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 125/332 (38%)
Asp 89..408 CDD:278455 124/327 (38%)
asp-4NP_510191.1 pepsin_retropepsin_like 88..411 CDD:386101 124/331 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.