DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and asp-8

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_503825.2 Gene:asp-8 / 178750 WormBaseID:WBGene00019105 Length:386 Species:Caenorhabditis elegans


Alignment Length:362 Identity:102/362 - (28%)
Similarity:171/362 - (47%) Gaps:47/362 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GSKVATLENL---------YNTEYYTT-LGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPC-- 128
            |.::|.::.|         :..||||. :..|.|.|..:|..||.|:||||...:|...  .|  
 Worm    41 GQELARIQQLSTGNVSFFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVFGVECRSQ--NCHG 103

  Fly   129 ----ANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEIT 189
                .:| :||.:||:|:.|..::||:.|....      :||...:||..|||::|::|.|...|
 Worm   104 GRGRRDR-EYNRTASSTFVAGTSSFNLPYDGGH------VSGNVGKDTAQFAGFTIQSQDFGIGT 161

  Fly   190 NAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNR-NGTNAINGGELI 253
            .|  |.......||:||||:.:.|:|..:....||:.|  :::.:|:.|..: |..|...||:::
 Worm   162 AA--TRLFGETFDGVLGLGWPATALNGTSTTMQNLLPQ--LDQKLFTTYFTKSNMHNGTAGGDIM 222

  Fly   254 LGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQ 318
            .|..|:......:.|||::...:|.:::...::..:...:....|.|..:....||..||     
 Worm   223 FGAIDTTHCQSQVNYVPLAYNSFWSYSVDGFSIGTYSRTQTETTIPDTSSGWTGVPNVVL----- 282

  Fly   319 ILGVLNPTA-----SNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYV----LRYGNTCVS--G 372
             .|::..|.     ::..:.:.|||...|||:|||:....:.:::.:||    |..|...:|  |
 Worm   283 -AGIVKATGATYDWNHQAYTLPCSSTATLPDMVFTIGGNSYNVRAVEYVVNLNLPNGQCALSLFG 346

  Fly   373 FTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPAI 409
            ..:.......|||:.||.:|...:|.....||||.||
 Worm   347 TAASQSGPAWILGDNFLRSYCHVFDFGNSRIGLAKAI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 96/351 (27%)
Asp 89..408 CDD:278455 97/337 (29%)
asp-8NP_503825.2 pepsin_like 65..381 CDD:133138 94/334 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.