DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and CTSD

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001900.1 Gene:CTSD / 1509 HGNCID:2529 Length:412 Species:Homo sapiens


Alignment Length:427 Identity:153/427 - (35%)
Similarity:219/427 - (51%) Gaps:56/427 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNL-----NVDDTKAK---TKTD 71
            |..||:....|.|...|||.||              |..||:..:     :|:|..||   :|..
Human     6 LLPLALCLLAAPASALVRIPLH--------------KFTSIRRTMSEVGGSVEDLIAKGPVSKYS 56

  Fly    72 TKVP----GSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRI 132
            ..||    |.....|:|..:.:||..:|.|.|||...|:.||||:||||.|..|......|....
Human    57 QAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHH 121

  Fly   133 KYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVN-----------FAGYSIKNQIFA 186
            ||||..|:||....|:|:|.|||.|      |||:.|||||:           ..|..::.|:|.
Human   122 KYNSDKSSTYVKNGTSFDIHYGSGS------LSGYLSQDTVSVPCQSASSASALGGVKVERQVFG 180

  Fly   187 EITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGE 251
            |.|..|...|:.::.|||||:.:..|::|::.|.|.|||.|.||::::||.||:|: .:|..|||
Human   181 EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRD-PDAQPGGE 244

  Fly   252 LILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANL-NGFQFC-ENCEAILDVGTSLIVVPEQVLD 314
            |:|||:||..|.|.|:|:.|:...|||..:....: :|...| |.||||:|.||||:|.|...:.
Human   245 LMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVR 309

  Fly   315 TINQILGVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRY---GNT-CVSGFTS 375
            .:.:.:|.:  ....|.:::.|..:..||.|...:..:.:.|...||.|:.   |.| |:|||..
Human   310 ELQKAIGAV--PLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMG 372

  Fly   376 MN----GNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            |:    ...|.|||::|:|.|||.:|.....:|.|.|
Human   373 MDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 130/344 (38%)
Asp 89..408 CDD:278455 129/339 (38%)
CTSDNP_001900.1 A1_Propeptide 22..49 CDD:400357 10/40 (25%)
Cathepsin_D2 73..408 CDD:133157 129/343 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.