DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and nots

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571879.1 Gene:nots / 114367 ZFINID:ZDB-GENE-010620-1 Length:416 Species:Danio rerio


Alignment Length:348 Identity:118/348 - (33%)
Similarity:178/348 - (51%) Gaps:30/348 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PGSKVATLENLYN---TEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNS 136
            ||.:|.  |.|||   .:::..:..|.|.|:..|:.||||::|||.||.|....  ||...|:.:
Zfish    70 PGRRVT--ERLYNFMDAQFFGQISLGRPEQNFTVVFDTGSSDLWVPSSYCVTQA--CALHNKFKA 130

  Fly   137 SASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQL 201
            ..|:||......|.|.|||..      |.|..::|.:......::||:|.|....|..:|:.:|.
Zfish   131 FESSTYTHDGRVFGIHYGSGH------LLGVMARDELKVGSVRVQNQVFGEAVYEPGFSFVLAQF 189

  Fly   202 DGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCL 266
            ||:|||||..:|....:|.|..:|.|.::::.|||.||..||:..  ||||:.|.:|...:...:
Zfish   190 DGVLGLGFPQLAEEKGSPVFDTMMEQNMLDQPVFSFYLTNNGSGF--GGELVFGANDESRFLPPI 252

  Fly   267 TYVPVSSAGYWQFTMTSANLNGF-----QFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPT 326
            .::||:..||||..:.:..:.|.     :..:.|:||:|.|||||..|.:.:..:.|.:|. .||
Zfish   253 NWIPVTQKGYWQIKLDAVKVQGALSFSDRSVQGCQAIVDTGTSLIGGPARDILILQQFIGA-TPT 316

  Fly   327 ASNGVFLVDCSSIGDLPDIVFTVARRKFPLKSSDYV----LRYGNTCVSGFTSMN----GNSLLI 383
            | ||.|:|||..:..||.:.|.:...::.|....||    |.....|.|||.|:.    ...:.|
Zfish   317 A-NGEFVVDCVRVSSLPVVSFLINSVEYSLSGEQYVRRETLNNKQICFSGFQSIEVPSPAGPVWI 380

  Fly   384 LGEIFLGAYYTTYDIVYKLIGLA 406
            ||::||...|:.||.....:|||
Zfish   381 LGDVFLSQVYSIYDRGENRVGLA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 113/339 (33%)
Asp 89..408 CDD:278455 111/331 (34%)
notsNP_571879.1 A1_Propeptide 20..48 CDD:285240
Asp 85..403 CDD:278455 109/329 (33%)
pepsin_retropepsin_like 86..403 CDD:299705 109/328 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.