DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and LOC101733630

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_012817292.3 Gene:LOC101733630 / 101733630 -ID:- Length:343 Species:Xenopus tropicalis


Alignment Length:342 Identity:127/342 - (37%)
Similarity:189/342 - (55%) Gaps:23/342 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSASTT 141
            |:|..|:    .:||..:|.|:|||:..|:.||||:||||.|..|......|....||:||.|:|
 Frog    14 SRVLYLQ----AQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSST 74

  Fly   142 YRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILG 206
            |....|||.|.||:.|      |||:.|:|||.....::|.|:|.|....|...|:.::.|||||
 Frog    75 YVKNGTAFAIQYGTGS------LSGYLSKDTVTIGNLAVKGQMFGEAVKQPGVTFVAAKFDGILG 133

  Fly   207 LGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPV 271
            :.:..|:::.:.|.|.|:|||.||..::||.||||| .:...||||:|||:|...|:|...|:.|
 Frog   134 MAYPVISVDGVPPVFDNIMAQKLVESNIFSFYLNRN-PDTQPGGELLLGGTDPKYYTGDFHYLNV 197

  Fly   272 SSAGYWQFTMTSANL-NGFQFCE-NCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFLV 334
            :...|||..|....: :....|: .||.|:|.|||||..|.:.:..:.:.:|.:  ....|.::|
 Frog   198 TRKAYWQIHMDQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAV--PLIQGQYMV 260

  Fly   335 DCSSIGDLPDIVFTVARRKFPLKSSDYVLRY---GNT-CVSGFTSMN----GNSLLILGEIFLGA 391
            .|..:..||.|..|:..:.:.|....|:::.   |:| |:|||..:|    ...|.|||::|:|.
 Frog   261 QCDKVPTLPVISLTLGGQVYTLTGEQYIMKVSQRGSTICLSGFMGLNIPPPAGPLWILGDVFIGQ 325

  Fly   392 YYTTYDIVYKLIGLAPA 408
            ||:.:|..|..:|.|.|
 Frog   326 YYSVFDRAYDRVGFAKA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 123/333 (37%)
Asp 89..408 CDD:278455 123/328 (38%)
LOC101733630XP_012817292.3 Cathepsin_D2 18..341 CDD:133157 123/335 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.