DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and VPS71

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_013671.1 Gene:VPS71 / 854966 SGDID:S000004505 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:44/166 - (26%)
Similarity:67/166 - (40%) Gaps:31/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRESNRIKDAEKKRVLDSTARQRRARKALEAL--------EQDNYHDDPHADLVMSKKLPKFQ 57
            :||...:||:...|.  :..|:      ..|.||        |...|   .|..::..:.|.:.|
Yeast   123 LTGVPRDRIESTTKP--ISQTS------DGLSALMGGSSFVKEHSKY---GHGWVLKPETLREIQ 176

  Fly    58 DSLKTGKEKKGKRKGAEYF-----LVKYRKNFQQLLEED----KDKQPNYESAAAPAPQK--PLR 111
            .|.|:.|..|.|||.....     ::..::|....|:..    .||...|.:.......|  ||.
Yeast   177 LSYKSTKLPKPKRKNTNRIVALKKVLSSKRNLHSFLDSALLNLMDKNVIYHNVYNKRYFKVLPLI 241

  Fly   112 HFCAVCGNF-SLYSCTACGTRYCCVRCLQTHQDTRC 146
            ..|::||.: |:.||..||.:.|.|.|.:.|.:|||
Yeast   242 TTCSICGGYDSISSCVNCGNKICSVSCFKLHNETRC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 11/28 (39%)
VPS71NP_013671.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3362
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104246
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.