DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and SEF

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_568545.1 Gene:SEF / 833676 AraportID:AT5G37055 Length:171 Species:Arabidopsis thaliana


Alignment Length:168 Identity:58/168 - (34%)
Similarity:79/168 - (47%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RESNRIKDAEKKRVLDSTARQRRARKA---LEALEQDN-------YHDDPHADLVMSKKLPKFQD 58
            |.|||.:....|.....|:...|.:.|   |||||.||       .:||..|.|.....|...|.
plant     9 RVSNRTRKVATKMAAALTSNDNRTQAAIARLEALENDNGAIEVIDLNDDEEASLDEDDDLGYLQK 73

  Fly    59 SLKTGKEKKG-KRKGAEYFLVKYR---KNFQQLLEEDK-----DKQPNY-ESAAAPAPQKPLRHF 113
                 |:.|| |||..:...::.|   |:|.:||:|..     ...|.| ::|..|......|:|
plant    74 -----KQHKGSKRKTRQAKALEARKAPKSFLELLQEANLESLPSHVPTYLKAAVGPPSSSSRRYF 133

  Fly   114 CAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWTA 151
            |:|||..:.|:|..||.|:|.:||...|:||||.|:.|
plant   134 CSVCGYIAGYNCCLCGMRFCSIRCQNIHKDTRCQKFVA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 14/27 (52%)
SEFNP_568545.1 zf-HIT 130..159 CDD:282314 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3362
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2377
OMA 1 1.010 - - QHG54994
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto3100
orthoMCL 1 0.900 - - OOG6_104246
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4014
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.