DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and Znhit1

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001297677.1 Gene:Znhit1 / 70103 MGIID:1917353 Length:158 Species:Mus musculus


Alignment Length:147 Identity:82/147 - (55%)
Similarity:103/147 - (70%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADL-VMSKKLPKFQDSLKTGKEKKGKRK 71
            |.:|..::||||..|||||..:.|||||.||:.|||||.| .:.|:||:|.|...|||:|| |.:
Mouse    13 RSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKK-KTR 76

  Fly    72 GAEYFLVKYRKNFQQLLEEDK---DKQPNYESAAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYC 133
            | ::|.:::|||||.||||..   .:.|||.:|.|..|.:|.|.||||||..|.|:|.:||.|||
Mouse    77 G-DHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYC 140

  Fly   134 CVRCLQTHQDTRCLKWT 150
            .||||.|||:|||||||
Mouse   141 TVRCLGTHQETRCLKWT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 18/27 (67%)
Znhit1NP_001297677.1 YL1_C <83..>139 CDD:382865 28/55 (51%)
zf-HIT 117..144 CDD:367943 16/26 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848649
Domainoid 1 1.000 96 1.000 Domainoid score I7349
eggNOG 1 0.900 - - E1_KOG3362
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4630
Inparanoid 1 1.050 162 1.000 Inparanoid score I4206
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54994
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto94334
orthoMCL 1 0.900 - - OOG6_104246
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3004
SonicParanoid 1 1.000 - - X4014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.