DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and znhit1

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001017056.2 Gene:znhit1 / 549810 XenbaseID:XB-GENE-5848028 Length:153 Species:Xenopus tropicalis


Alignment Length:146 Identity:84/146 - (57%)
Similarity:104/146 - (71%) Gaps:5/146 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMSKKLPKFQDSLKTGKEKKGKRKG 72
            |..|..::|||||..||||..:.|||||:||:.|||||:|...|:||:|.|..:|||:|| |.:|
 Frog     9 RSNDPNQRRVLDSATRQRRLNRQLEALEKDNFQDDPHANLPQLKRLPQFDDEAETGKKKK-KTRG 72

  Fly    73 AEYFLVKYRKNFQQLLEE---DKDKQPNYESAAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYCC 134
             ::|..::|||||.||||   ...:.|||.:|.|.|...|.||||:|||..|.|||.:||.||||
 Frog    73 -DHFKQRFRKNFQALLEEQNLSSCEGPNYLTACASASTFPQRHFCSVCGFPSNYSCVSCGARYCC 136

  Fly   135 VRCLQTHQDTRCLKWT 150
            ||||.|||:|||||||
 Frog   137 VRCLVTHQETRCLKWT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 20/27 (74%)
znhit1NP_001017056.2 zf-HIT 112..139 CDD:367943 18/26 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7179
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4630
Inparanoid 1 1.050 170 1.000 Inparanoid score I4015
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto104544
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3004
SonicParanoid 1 1.000 - - X4014
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.