DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and znhit1

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001017401.1 Gene:znhit1 / 407699 ZFINID:ZDB-GENE-050417-272 Length:154 Species:Danio rerio


Alignment Length:147 Identity:79/147 - (53%)
Similarity:104/147 - (70%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADL-VMSKKLPKFQDSLKTGKEKKGKRK 71
            |.:|..::|||||..|.||..:.|||||:||:.|||||.| .:.|:||:|.:|.::||.:| |.:
Zfish     9 RSQDPGQRRVLDSATRLRRLSRQLEALEKDNFQDDPHASLPQLVKRLPQFDESNESGKRRK-KTR 72

  Fly    72 GAEYFLVKYRKNFQQLLEEDK---DKQPNYESAAAPAPQKPLRHFCAVCGNFSLYSCTACGTRYC 133
            | ::|..::|||||.||||:.   .:.|||.:|.|...:.|.||||||||..|.|:|.:||.|||
Zfish    73 G-DHFKQRFRKNFQTLLEEEDLSVSEGPNYLTACAEPSKIPQRHFCAVCGFPSNYTCVSCGARYC 136

  Fly   134 CVRCLQTHQDTRCLKWT 150
            |||||.||.:|||||||
Zfish   137 CVRCLGTHHETRCLKWT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 20/27 (74%)
znhit1NP_001017401.1 YL1_C 59..>135 CDD:295195 35/77 (45%)
zf-HIT 113..140 CDD:282314 18/26 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594155
Domainoid 1 1.000 86 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_KOG3362
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4630
Inparanoid 1 1.050 156 1.000 Inparanoid score I4252
OMA 1 1.010 - - QHG54994
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto39499
orthoMCL 1 0.900 - - OOG6_104246
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3004
SonicParanoid 1 1.000 - - X4014
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.