DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and zhit-1

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001122894.1 Gene:zhit-1 / 183878 WormBaseID:WBGene00016992 Length:194 Species:Caenorhabditis elegans


Alignment Length:179 Identity:72/179 - (40%)
Similarity:99/179 - (55%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMSKKLPKFQDSL-------- 60
            |.|:||.:.|..|.||..||:.|..:.|:.|||||.||||||:||.:|..|||.|.:        
 Worm    16 RASSRISNLEGNRTLDENARRNRRNRQLDGLEQDNSHDDPHANLVWNKNAPKFDDEMIGGPSAKK 80

  Fly    61 -------KTG---KEKKGKRKGA--EYFLVKYRKNFQ-QLLEEDK----DKQPN------YESAA 102
                   |:|   .||..:||.|  |:...:::|:|. .::|:.|    ..:|:      |:.::
 Worm    81 AKKVKEDKSGIVHGEKARRRKLARPEFNKQRFKKSFNAHVIEQSKAILDSAEPDYRRVNAYQLSS 145

  Fly   103 APAPQKPLRHFCAVCGNFSLYSCTACGTRYCCVRCLQTHQDTRCLKWTA 151
            ||..:||.|.||||||..|.|.||.||.:||.:.|...|.||||:||.|
 Worm   146 APPSEKPARKFCAVCGIISKYCCTRCGAKYCSLPCRDVHNDTRCMKWLA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 16/27 (59%)
zhit-1NP_001122894.1 YL1_C 100..>175 CDD:382865 27/74 (36%)
zf-HIT 154..180 CDD:367943 15/25 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4630
Inparanoid 1 1.050 128 1.000 Inparanoid score I3242
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54994
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto18405
orthoMCL 1 0.900 - - OOG6_104246
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3004
SonicParanoid 1 1.000 - - X4014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.