DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31917 and AgaP_AGAP007853

DIOPT Version :9

Sequence 1:NP_608895.1 Gene:CG31917 / 326171 FlyBaseID:FBgn0031668 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_317641.2 Gene:AgaP_AGAP007853 / 1278104 VectorBaseID:AGAP007853 Length:157 Species:Anopheles gambiae


Alignment Length:157 Identity:111/157 - (70%)
Similarity:127/157 - (80%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRESNRIKDAEKKRVLDSTARQRRARKALEALEQDNYHDDPHADLVMSKKLPKFQDSLK-TGK 64
            |.||||.||::|:|||.||..|||||||||||||||||:|:|||||||||||:|||.|:|. :|.
Mosquito     1 MAGRESGRIREADKKRTLDDAARQRRARKALEALEQDNFHEDPHADLVMSKKVPKFSDNLDGSGP 65

  Fly    65 EKKGKR--KGAEYFLVKYRKNFQQLLEEDKDKQ---PNYESAAAPAPQKPLRHFCAVCGNFSLYS 124
            .||..|  |||||:..||||.|.|||:|::.::   |||.||||||.:.|.||||||||..|.|:
Mosquito    66 SKKKHRRTKGAEYYRAKYRKTFPQLLDEERQQRPDPPNYFSAAAPASRLPERHFCAVCGFPSSYT 130

  Fly   125 CTACGTRYCCVRCLQTHQDTRCLKWTA 151
            ||||||||||||||.||||||||||||
Mosquito   131 CTACGTRYCCVRCLGTHQDTRCLKWTA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31917NP_608895.1 zf-HIT 111..139 CDD:282314 23/27 (85%)
AgaP_AGAP007853XP_317641.2 YL1_C 57..>138 CDD:295195 46/80 (58%)
zf-HIT 116..143 CDD:282314 21/26 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I9544
eggNOG 1 0.900 - - E1_KOG3362
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4630
Inparanoid 1 1.050 225 1.000 Inparanoid score I5905
OMA 1 1.010 - - QHG54994
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004902
OrthoInspector 1 1.000 - - oto109780
Panther 1 1.100 - - LDO PTHR13093
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4014
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.