DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2alpha and LOC100491668

DIOPT Version :9

Sequence 1:NP_001285329.1 Gene:eIF2alpha / 32617 FlyBaseID:FBgn0261609 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002937250.4 Gene:LOC100491668 / 100491668 -ID:- Length:328 Species:Xenopus tropicalis


Alignment Length:301 Identity:142/301 - (47%)
Similarity:197/301 - (65%) Gaps:6/301 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTSRFYNERYPEIEDVVMVNVLSIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINKLIRVGKT 67
            |:.|||..:.|.::|||||.||:|.|.||||.|||||.|:.||.|.|||..||.||.:::||.:.
 Frog    27 LSGRFYKNQQPNVDDVVMVKVLAIFEHGAYVMLLEYNCIKAMIYLKELSTTRIHSIGRILRVRRK 91

  Fly    68 EPVVVIRVDKEKGYIDLSKRRVSPEDVEKCTERFAKAKAINSLLRHVADILGFEGNEKLEDLYQK 132
            ..:.||:|.|:.|||:||||.::||.|:||.:::.|::.:..:|..||.:||:..:::||.|.::
 Frog    92 ACLRVIKVAKDTGYINLSKRSITPEQVKKCEDKYKKSETVFRILFRVARVLGYTEDKQLESLCRR 156

  Fly   133 TAWHFEKKYNNKTV-AYDIFKQSVTDPTVFDECNLEPETKEVLLSNIKRKLVSPTVKIRADIECS 196
            |||.|:.:||.... ||..||.||.||:|.|...|....:.||.:.|||:||.|.|||:||:|.:
 Frog   157 TAWVFDDRYNCPGYGAYAAFKHSVFDPSVLDGLTLNERERRVLTNTIKRRLVPPVVKIQADVEVA 221

  Fly   197 CYGYEGIDAVKASLTKGLELSTEELPIRIN-----LIAPPLYVMTTSTTKKTDGLKALEVAIEHI 256
            ||.||||||||.:|..||..|||.:||:||     .||.|.|.:||:|.::.:|..||..||:.|
 Frog   222 CYRYEGIDAVKDALRAGLSCSTENMPIKINQIKAIKIASPCYAITTTTQRRWEGTSALNQAIQAI 286

  Fly   257 RAKTSEYDGEFKVIMAPKLVTAIDEADLARRLERAEAENAQ 297
            :||..|..|.|.|.|.||::....|..||:..||.:.|||:
 Frog   287 KAKIEEKRGVFNVQMEPKVIAPTVELQLAQLFERLQTENAR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2alphaNP_001285329.1 SUI2 6..278 CDD:224018 133/277 (48%)
S1_IF2_alpha 13..88 CDD:239899 42/74 (57%)
EIF_2_alpha 130..239 CDD:284872 57/114 (50%)
LOC100491668XP_002937250.4 PTZ00248 30..325 CDD:240329 138/294 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5021
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1093186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48573
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1812
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.