DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and SPHK1

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_892010.2 Gene:SPHK1 / 8877 HGNCID:11240 Length:470 Species:Homo sapiens


Alignment Length:386 Identity:98/386 - (25%)
Similarity:157/386 - (40%) Gaps:77/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKTYV--EELATLPDAIV 115
            ||.:|||::||...|.::.:.|:::.:|:|..|..|..::.|....||:..|  |||... ||:|
Human    99 RPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRW-DALV 162

  Fly   116 VAGGDGTSSEVVTGLMRR----RGNLCPITILPLGRSVQSASKRINIFGVKDVDYVKSLS----- 171
            |..|||...|||.|||.|    .....|:..||.|.....|:...:..|.:.|.....|:     
Human   163 VMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLL 227

  Fly   172 ---KALEPMLKDESQYQSVIRFDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGPL 233
               :.|.||             ::::....|..:|   |.:..|:||.:.|:|...:||...|.:
Human   228 LCRRLLSPM-------------NLLSLHTASGLRL---FSVLSLAWGFIADVDLESEKYRRLGEM 276

  Fly   234 RHYAS-----AASKSFADNWS-LKTDYV--YTPPCP-----GCVDCAATVQRQE------TAQPS 279
            |....     ||.:::....: |....|  .||..|     |.|| |..|..:|      |..|.
Human   277 RFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVD-AHLVPLEEPVPSHWTVVPD 340

  Fly   280 GLFTRGLIKYKNNPGETKRPLVKNDNCSKKFE---GSAEASQININCVQNKDNFAELESQFISSL 341
            ..|...|....::.|            |:.|.   |...|..:::..|:...:.|.|...|: ::
Human   341 EDFVLVLALLHSHLG------------SEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFL-AM 392

  Fly   342 QPGWEFIKQIPEVTCSKILPSLVVKSRTIQLHPDGEMGEKFYSIDGEEYDARPIKVSVVPN 402
            :.|...     |..|..::...||..|   |.|  :.|:..:::|||...:..::..|.||
Human   393 EKGRHM-----EYECPYLVYVPVVAFR---LEP--KDGKGVFAVDGELMVSEAVQGQVHPN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 96/384 (25%)
DAGK_cat 56..>146 CDD:279163 35/95 (37%)
SPHK1NP_892010.2 PLN02958 <97..431 CDD:215517 95/372 (26%)
DAGK_cat 102..>207 CDD:279163 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.