DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and SPHK2

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_016882497.1 Gene:SPHK2 / 56848 HGNCID:18859 Length:716 Species:Homo sapiens


Alignment Length:196 Identity:49/196 - (25%)
Similarity:88/196 - (44%) Gaps:31/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKTYVEELATLP-DAIVV 116
            ||.::|:::||...:..:.::.||:..|::..||.|..:::|....||:..|:.|:... |.||.
Human   241 RPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGIVT 305

  Fly   117 AGGDGTSSEVVTGLMRR----RGNLCPITILPLGRSVQSASKRINIFG----VKDVDYVKSLSKA 173
            ..|||...||:.||:.|    .....|:.|||.| |..:.:..:|..|    ...:|.:.:.|..
Human   306 VSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCG-SGNALAGAVNQHGGFEPALGLDLLLNCSLL 369

  Fly   174 L-----EPMLKDESQYQSVIRFDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGPL 233
            |     .|:             |:::....|.|:   .|....::||.:.|:|...:::...|..
Human   370 LCRGGGHPL-------------DLLSVTLASGSR---CFSFLSVAWGFVSDVDIQSERFRALGSA 418

  Fly   234 R 234
            |
Human   419 R 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 47/194 (24%)
DAGK_cat 56..>146 CDD:279163 29/94 (31%)
SPHK2XP_016882497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.