Sequence 1: | NP_723549.1 | Gene: | Mulk / 326168 | FlyBaseID: | FBgn0260750 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016882497.1 | Gene: | SPHK2 / 56848 | HGNCID: | 18859 | Length: | 716 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 49/196 - (25%) |
---|---|---|---|
Similarity: | 88/196 - (44%) | Gaps: | 31/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 RPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKTYVEELATLP-DAIVV 116
Fly 117 AGGDGTSSEVVTGLMRR----RGNLCPITILPLGRSVQSASKRINIFG----VKDVDYVKSLSKA 173
Fly 174 L-----EPMLKDESQYQSVIRFDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGPL 233
Fly 234 R 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mulk | NP_723549.1 | LCB5 | 55..407 | CDD:224513 | 47/194 (24%) |
DAGK_cat | 56..>146 | CDD:279163 | 29/94 (31%) | ||
SPHK2 | XP_016882497.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1597 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |