DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and Sphk2

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001012066.1 Gene:Sphk2 / 308589 RGDID:1307757 Length:616 Species:Rattus norvegicus


Alignment Length:231 Identity:54/231 - (23%)
Similarity:95/231 - (41%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKTYVEELATLP-DAIVV 116
            |..::|:::||...:..:.:...::..|::..||.|..:::|....||:..|:.|:... :.||.
  Rat   144 RKPRLLLLVNPFGGRGLAWQRCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVT 208

  Fly   117 AGGDGTSSEVVTGLMRR----RGNLCPITILPLGRSVQSASKRINIFG----VKDVDYVKSLSKA 173
            ..|||...||:.||:.|    .....||.:||.| |..:.:..:|..|    ...||.:.:.|..
  Rat   209 VSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLPCG-SGNALAGAVNHHGGFEQTVGVDLLLNCSLL 272

  Fly   174 L-----EPMLKDESQYQSVIRFDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGPL 233
            |     .|:             |:::....|.|:   .|....::||.|.|:|...:::...|..
  Rat   273 LCRGGSHPL-------------DLLSVTLASGSR---CFSFLSVAWGFLSDVDIHSERFRALGSA 321

  Fly   234 RHYASAASKSFADNWSLKTDYVYTP-------PCPG 262
            | :...|....|...:.:....|.|       |.||
  Rat   322 R-FTLGAVLGLATLHTYRGRLSYLPATTEPALPIPG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 53/229 (23%)
DAGK_cat 56..>146 CDD:279163 26/94 (28%)
Sphk2NP_001012066.1 PLN02958 <152..607 CDD:215517 52/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.