DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and Sphk1

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001257740.1 Gene:Sphk1 / 170897 RGDID:620048 Length:458 Species:Rattus norvegicus


Alignment Length:390 Identity:95/390 - (24%)
Similarity:152/390 - (38%) Gaps:86/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKTYV--EELATLPDAIV 115
            ||.:|||::||...|.::.|.|::...|:|..|..|.:::.|....||:..|  |||... ||:.
  Rat    88 RPCRVLVLLNPRGGKGKALKLFQSRVRPLLEEAEVSFKLMLTERQNHARELVCAEELGHW-DALA 151

  Fly   116 VAGGDGTSSEVVTGLMRR----RGNLCPITILPLGRSVQSASKRINIFG----VKDVDYVKSLS- 171
            |..|||...|||.|||.|    .....|:..|| |.|..:.:..:|.:.    |.:.|.:.:.: 
  Rat   152 VMSGDGLMHEVVNGLMERPDWESAIQKPLCSLP-GGSGNALAASLNYYAGHEQVTNEDLLINCTL 215

  Fly   172 ----KALEPMLKDESQYQSVIRFDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGP 232
                :.|.||             ::::....|..||   :.:..||||.:.|:|...:||...|.
  Rat   216 LLCCRQLSPM-------------NLLSLHTASGRQL---YSVLSLSWGFVADVDLESEKYRSLGE 264

  Fly   233 LRH----------------------YASAASKSFADNWSLKTDYVYTPPCPGCVDCAATVQRQET 275
            :|.                      ...||||..|.:.:.|     .|.....|.....|....|
  Rat   265 IRFTVGTFFRLASLRIYQGQLAYLPVGKAASKIPASSLAQK-----GPANTYLVPLEEPVPPHWT 324

  Fly   276 AQPSGLFTRGLIKYKNNPGETKRPLVKNDNCSKKFE---GSAEASQININCVQNKDNFAELESQF 337
            ..|...|...|:            |:.....::.|.   |..||..:::..::...:.|.|...|
  Rat   325 VVPEQDFVLVLV------------LLHTHLSTEMFAAPMGRCEAGVMHLFYIRAGVSRAMLLRLF 377

  Fly   338 ISSLQPGWEFIKQIPEVTCSKILPSLVVKSRTIQLHPDGEMGEKFYSIDGEEYDARPIKVSVVPN 402
            : ::|.|...     ::.|..::...||..|   |.|..:.|  .:|:|||......::..|.||
  Rat   378 L-AMQKGKHM-----DLDCPYLVHVPVVAFR---LEPRNQRG--VFSVDGELMVCEAVQGQVHPN 431

  Fly   403  402
              Rat   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 93/388 (24%)
DAGK_cat 56..>146 CDD:279163 35/95 (37%)
Sphk1NP_001257740.1 LCB5 91..443 CDD:224513 93/387 (24%)
DAGK_cat 91..197 CDD:279163 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.