DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and SPHK2

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001190787.1 Gene:SPHK2 / 10723114 AraportID:AT4G21534 Length:481 Species:Arabidopsis thaliana


Alignment Length:207 Identity:59/207 - (28%)
Similarity:90/207 - (43%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MREFASNIQANWISDRPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYSVEILRTNHIGHAKT 102
            :|::..::      .|||::||.:||...||.:.:.|....:|:...|...:||..|.:..|||.
plant   103 LRQYLDSL------GRPKRLLVFVNPFGGKKSAREIFVKEVKPLFEDADVQLEIQETKYQLHAKE 161

  Fly   103 YVEEL-ATLPDAIVVAGGDGTSSEVVTGLMRR---RGNL-CPITILPLGRSVQSASKRINIFGVK 162
            :|:.: .:..|.||...|||...|||.||:.|   |..| .||.::|.|..              
plant   162 FVKSMDVSKYDGIVCVSGDGILVEVVNGLLERADWRNALKLPIGMVPAGTG-------------- 212

  Fly   163 DVDYVKSLSKALEPMLKDESQYQSVIR-----FDVINEEDGSNSQLKPIFGLNGLSWGLLEDIDA 222
             ...:|||...:.......|...|:||     .||.....|:..    .|.:..|:|||:.|||.
plant   213 -NGMIKSLLDTVGLRCCANSATISIIRGHKRSVDVATIAQGNTK----FFSVLMLAWGLIADIDI 272

  Fly   223 AKDKYWYFGPLR 234
            ..:|:.:.|..|
plant   273 ESEKFRWMGSAR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 56/190 (29%)
DAGK_cat 56..>146 CDD:279163 33/94 (35%)
SPHK2NP_001190787.1 PLN02958 1..480 CDD:215517 59/207 (29%)
DAGK_cat 115..249 CDD:279163 43/148 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12358
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.