DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mulk and sphk2

DIOPT Version :9

Sequence 1:NP_723549.1 Gene:Mulk / 326168 FlyBaseID:FBgn0260750 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_021322621.1 Gene:sphk2 / 100150090 ZFINID:ZDB-GENE-100922-225 Length:869 Species:Danio rerio


Alignment Length:338 Identity:74/338 - (21%)
Similarity:134/338 - (39%) Gaps:74/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ALQALKTHIEIEQHMREFASNIQANWISDRPKKVLVVMNPVANKKRSEKFFKNYCEPVLHLAGYS 88
            |:|:|...:::.. ..||..:     :..||:::|:::||.:.:.::.::.:.:..|::..|..|
Zfish   137 AIQSLLRGMDVSS-TTEFCKS-----MLPRPRRLLLLVNPFSGRGQAMQWCQTHILPMIREANIS 195

  Fly    89 VEILRTNHIGHAKTYVEELATLP--DAIVVAGGDGTSSEVVTGLMRR----RGNLCPITILPLGR 147
            ..:::|....||:..:.|: :||  |.||:..|||...||:.|||.|    :....|:.|||.| 
Zfish   196 YNLIQTERQNHARELIREI-SLPEWDGIVIVSGDGLLHEVINGLMERPDWEQAIKTPVGILPCG- 258

  Fly   148 SVQSASKRINIF----------------------GVKDVDYVKSLSKALEPMLKDESQYQSVIRF 190
            |..:.:..||..                      |||.:|.|   |....|.....:        
Zfish   259 SGNALAGSINHHAGYDMCLREPLLLNCCFLLCRGGVKPLDLV---SVTTSPCASSST-------- 312

  Fly   191 DVINEEDGSNSQLKPIFGLNGLSWGLLEDIDAAKDKYWYFGPLRHYASAASKSFADNWSLKTDYV 255
               :.::|.....:.:|....::||.:.|:|...::|...|..| :........|...|.|....
Zfish   313 ---SNQNGHPPAPRRLFSFLSVAWGFVSDVDIESERYRGLGSAR-FTLGTLVRLASLRSYKGRLS 373

  Fly   256 YTPPCPGCVDCAATVQRQETAQP-------SGLFTRGLIKYKNNP--------GETKRPLVKNDN 305
            |.||        |.|.....|.|       |...|.||..:...|        |.:::..::.|:
Zfish   374 YLPP--------AVVNPSPDATPQPPRRPLSRSITEGLEGFCRTPIHRTCSDMGLSEQRSLRKDD 430

  Fly   306 CSKKFEGSAEASQ 318
            ..::.|...|..:
Zfish   431 GERERERERERQE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MulkNP_723549.1 LCB5 55..407 CDD:224513 67/307 (22%)
DAGK_cat 56..>146 CDD:279163 28/95 (29%)
sphk2XP_021322621.1 LCB5 <168..>376 CDD:332482 51/224 (23%)
LCB5 <745..844 CDD:332482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.