DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and AT1G33020

DIOPT Version :10

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_174578.1 Gene:AT1G33020 / 840197 AraportID:AT1G33020 Length:548 Species:Arabidopsis thaliana


Alignment Length:61 Identity:22/61 - (36%)
Similarity:36/61 - (59%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 VEHVHNLRIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFKFFETTIQIE-EYSP 653
            |..||.|.||::::.||:|::.::|..:||...||::....|    |....|||:| |.:|
plant   492 VTAVHELHIWSITVGKVSLASQVSIKPEADTDAILDKVIEYI----KRHHVTIQVEKEQNP 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CzcD 312..649 CDD:440843 19/54 (35%)
AT1G33020NP_174578.1 F-box 7..49 CDD:425796
F_box_assoc_1 110..338 CDD:273726
CzcD <492..543 CDD:440843 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.