DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT33D and SLC30A3

DIOPT Version :9

Sequence 1:NP_723732.2 Gene:ZnT33D / 326167 FlyBaseID:FBgn0051860 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_005264604.1 Gene:SLC30A3 / 7781 HGNCID:11014 Length:412 Species:Homo sapiens


Alignment Length:112 Identity:44/112 - (39%)
Similarity:64/112 - (57%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 DSTKTVTITGHSHITAKWDGHCHFKERE-------TGVDKAARRVLIIACILCTIFLILEVIGGI 360
            :.:|.|.:..|         |||   |:       |.....|||.|..||.:|.:|:..||:||.
Human    43 EESKPVEMPFH---------HCH---RDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGY 95

  Fly   361 LSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAE 407
            |::||||.|||||||.|:.|.:.|:.:|.|:.||::..:.:||||:|
Human    96 LAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT33DNP_723732.2 CDF 350..651 CDD:273544 29/58 (50%)
Cation_efflux 350..572 CDD:279834 29/58 (50%)
SLC30A3XP_005264604.1 Cation_efflux 85..>142 CDD:279834 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152430
Domainoid 1 1.000 186 1.000 Domainoid score I3351
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74470
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D351752at33208
OrthoFinder 1 1.000 - - FOG0000470
OrthoInspector 1 1.000 - - otm41461
orthoMCL 1 0.900 - - OOG6_100508
Panther 1 1.100 - - O PTHR11562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X541
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.