DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tap42 and ppfr-4

DIOPT Version :10

Sequence 1:NP_723811.1 Gene:Tap42 / 326166 FlyBaseID:FBgn0051852 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001370777.1 Gene:ppfr-4 / 190617 WormBaseID:WBGene00022193 Length:327 Species:Caenorhabditis elegans


Alignment Length:30 Identity:11/30 - (36%)
Similarity:18/30 - (60%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SKAAVPLEKKLDKRGLLS---LGYGYGING 54
            ||.|..:.||:..:.|::   :.||||.:|
 Worm   628 SKYAENIFKKMQHKSLITWNLMIYGYGSHG 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tap42NP_723811.1 TAP42 14..367 CDD:461209 11/30 (37%)
ppfr-4NP_001370777.1 TAP42 11..317 CDD:461209
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.