DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and SFH5

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:33/187 - (17%)
Similarity:70/187 - (37%) Gaps:63/187 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VFKTVDGFQDYPDYLQSLVEMDDLIFESLLLLPRV--QQNGITVICDLQGTNRNFLRQFSPAFMK 167
            :|:.||.|..|                      |:  .:.|:::: |...::.|::.|       
Yeast   137 LFQNVDKFVRY----------------------RIGLMEKGLSLL-DFTSSDNNYMTQ------- 171

  Fly   168 VVNEKNGVLPF---------SQRIVHIIQR--------GFLMHVTST------LFMPFMNKEFKE 209
             |::..||..:         |:.::.|.|:        .:.::|.:.      |...|:::..::
Yeast   172 -VHDYKGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRK 235

  Fly   210 K-IFTHDGRHLSKLREMVGYESLPAEYGG--PATNVLDTNLIFNHLSQNAEYLEKLQ 263
            | :...||..|.:..:...||.    |||  ...|:...|:...|.::...|:.:.|
Yeast   236 KFVVLTDGSKLGQYLKDCPYEG----YGGKDKKNNLTKQNVTNVHPTEYGLYILQKQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024
CRAL_TRIO 92..237 CDD:279044 26/157 (17%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 28/160 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.