DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Ttpal

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_083788.2 Gene:Ttpal / 76080 MGIID:1923330 Length:343 Species:Mus musculus


Alignment Length:265 Identity:67/265 - (25%)
Similarity:106/265 - (40%) Gaps:38/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLVEK-CEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPIEHYR 81
            ::.||.:|.| ...|....:|..|.:||...::|..:|.|.:.:|:..:|..|        |.:.
Mouse    59 VQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRRSWP--------EVFS 115

  Fly    82 QL-------FYGTHCRYVMPQADRSG-RVLVVFKTVDGF--QDYPDYLQSLVEMDDLIFESLLLL 136
            .|       ...:....|:|..|..| .||.:  ..|.:  .:||  :...:....|..|.|:..
Mouse   116 NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCI--RPDRWIPSNYP--ITENIRAVYLTLEKLIQS 176

  Fly   137 PRVQQNGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVL----PFSQRIVHIIQRGFLMHVTST 197
            ...|.|||.::.|.:|.:.:....|.|...|.|   .|:|    |...:.|||:....:......
Mouse   177 EETQVNGIVILADYKGVSLSKASHFGPFIAKKV---IGILQDGFPIRIKAVHIVNEPRIFKGIFA 238

  Fly   198 LFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLDTNLIFNHLSQNAEYLEKL 262
            :..||:.::...:.|.| |..|:.|...:....||.||||.| ..|||      .|.||..|...
Mouse   239 IIKPFLKEKIANRFFLH-GSDLNSLHTNLPRNILPKEYGGTA-GELDT------ASWNAVLLASE 295

  Fly   263 QTYGK 267
            :.:.|
Mouse   296 EDFVK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/43 (28%)
CRAL_TRIO 92..237 CDD:279044 39/151 (26%)
TtpalNP_083788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CRAL_TRIO_N 57..103 CDD:215024 12/43 (28%)
SEC14 122..278 CDD:238099 40/163 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.