DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:280 Identity:61/280 - (21%)
Similarity:111/280 - (39%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH------PTWVARHPIE 78
            :|||.:::....::..::.:| :||....::..||.:.:.....::::|      .||.....:.
Mouse   261 RLRQWLQETHKGKIPKDEHIL-RFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLL 324

  Fly    79 HYRQLFY--GTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLIFESLLL------ 135
            .|    |  |.|      ..|:.||.|.|.:.  |..|....:::|.|      |:||.      
Mouse   325 DY----YAGGWH------HHDKDGRPLYVLRL--GQMDTKGLVRALGE------EALLRYVLSIN 371

  Fly   136 ---LPRVQQN---------GITVICDLQGTN-RNFLRQFSPAFMKVVNEKNGVLPFSQRIVHIIQ 187
               |.|.::|         ..|.:.||:|.| |:..|....|.::::.......|.:...:.|::
Mouse   372 EEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILR 436

  Fly   188 RGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHL---SKLREMVGYESLPAEYGGPA-TNVLDTNLI 248
            ...:..|..||..||::...:.|...:.|...   ..|.:.:..|.:|....|.. .:|.:..|:
Mouse   437 APRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPEGGLV 501

  Fly   249 FNHLSQNAEYLE----KLQT 264
            ...|.:.||.||    ||.|
Mouse   502 PKSLYRTAEELENEDLKLWT 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 8/40 (20%)
CRAL_TRIO 92..237 CDD:279044 35/166 (21%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 54/267 (20%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 8/40 (20%)
CRAL_TRIO 326..490 CDD:279044 39/181 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.